KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1188Help
Entry
NMB1188           CDS       T00027                                 

Gene name
ilvD-2
Definition
(RefSeq) dihydroxy-acid dehydratase
  KO
K01687  
dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    NMB1188 (ilvD-2)
   01230 Biosynthesis of amino acids
    NMB1188 (ilvD-2)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    NMB1188 (ilvD-2)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NMB1188 (ilvD-2)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     NMB1188 (ilvD-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1187359..1189218)
Genome map
AA seq 619 aa AA seqDB search
MPEYRSKTSTHGRNMAGARALWRATGVMETDFGKPIIAVANSFTQFVPGHVHLHNMGQLV
AREIEKAGAIAKEFNTIAIDDGIAMGHSGMLYSLPSRDLIADSIEYMVNAHCADALVCIS
NCDKITPGMLIAAMRLNIPTIFVSGGPMEAGKVIGVANIQPERRLDLIDAMIESADDNVS
NRQVEEVEQNACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSYLATHAGRKELFLEAGR
MIVEITKRYYEQNDETVLPRSIATKKAFENAMTMDIAMGGSTNTILHLLAVANEAGVDFK
MADIDRLSRVVPCICKTAPNNHDYYMEDVHRAGGIFAILKELDKAGKLHTDVHTIHAPTL
KDAIEQWDVTNPENTRAIERFKAAPGGVRTTQAFSQNRMWKTLDLDREKGCIRDVAHAYS
QDGGLAVLFGNIAERGCVVKTAGVDESILKFTGRARVFESQEDAVEGILGNQIVAGDIVI
IRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHASPEAAEGGA
IGLVHEGDTVEIDIPNRSIHLAISDEELAARRAEMEARGSKAWKPKNRDRYVSAALRAYG
AMATSADKGAVRDVAQIER
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaataccgctccaaaacctccacccacggccgcaatatggcgggcgcacgtgca
ttgtggcgcgccaccggcgtgatggaaaccgacttcggcaagcccatcatcgccgttgcc
aactccttcacccaattcgtgcccggccatgtccacctgcacaatatgggccagctggtt
gcccgcgaaatcgaaaaagccggcgcaatcgccaaagaattcaacaccatcgccatcgac
gacggcatcgctatgggacacagcggcatgctgtactccctgcccagccgcgatttgatt
gccgactctatcgaatatatggtcaacgcccactgcgccgacgcgctggtgtgcatttcc
aactgcgacaaaatcaccccgggcatgctgattgccgcgatgcgcctgaacatccccacc
atcttcgtctccggcggcccgatggaagcgggcaaggttatcggcgtggcaaacatccag
cccgaacgccgtttggacttgattgacgcgatgattgaatcggcggacgacaatgtcagc
aaccggcaagtcgaggaagtcgaacaaaacgcctgcccgacctgcggctcgtgttcgggt
atgtttacggcaaactcgatgaactgcctgaccgaagcactcggcctttccctgcccggc
aacggttcgtatttggcgacccacgccggccgcaaagaattgttcctcgaagccggccgt
atgattgtcgaaatcaccaaacgctattacgagcaaaacgatgaaaccgtgttaccgcgc
agcattgccaccaaaaaagcgtttgaaaacgctatgacgatggatattgcgatgggcggc
agcaccaataccattttgcacctgttggccgttgccaacgaagccggtgtcgatttcaaa
atggcagacatcgaccgcttaagccgcgtcgtgccctgcatctgcaaaaccgcacccaac
aaccacgactactatatggaagacgtgcatcgcgccggcggtatcttcgccatcctgaaa
gaactggacaaagcgggcaaactgcacaccgacgtgcacaccatccacgcgccgacgctg
aaagacgcgattgaacaatgggacgtgaccaatcccgaaaacacccgtgccatcgaacgc
ttcaaagccgcgccgggcggcgtacgcaccacccaagcgttctcgcaaaaccgtatgtgg
aaaaccctcgacctcgaccgcgaaaaaggctgtatccgcgacgtggcacacgcctactcg
caagacggcggtttggcggtcttgttcggcaacatcgccgagcgcggctgcgtggtaaaa
accgcaggcgtggacgagagcatcctcaaattcaccggccgcgcccgcgtgtttgaaagc
caagaagacgcagtagaaggcattttgggcaaccaaatcgtcgctggcgacatcgtcatc
atccgctacgaaggcccgaaaggcggcccgggcatgcaggaaatgctgtatccgacttcc
tacctgaaatctaaaggcctcggcaaagcctgcgctctcttaaccgacggacgcttctcc
ggcggcacatcaggtttgtccatcggacacgcctcgcccgaagcggcggaaggtggcgcg
atcggtttggtacacgaaggcgataccgtcgaaatcgacatccccaaccgcagcatccac
cttgccatttccgatgaagagcttgccgcacgccgtgccgaaatggaagcgcgcggcagc
aaagcatggaagcctaaaaaccgcgaccgctacgtctccgccgcattaagagcttacggc
gcgatggcgacttccgccgacaaaggcgcggtgcgcgacgtagcgcaaatcgaaagataa

DBGET integrated database retrieval system