KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1191Help
Entry
NMB1191           CDS       T00027                                 

Gene name
cysN-2
Definition
(RefSeq) sulfate adenylyltransferase subunit 1
  KO
K00956  
sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Purine metabolism
Monobactam biosynthesis
Selenocompound metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NMB1191 (cysN-2)
  Nucleotide metabolism
   00230 Purine metabolism
    NMB1191 (cysN-2)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    NMB1191 (cysN-2)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    NMB1191 (cysN-2)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     NMB1191 (cysN-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1192998..1194284)
Genome map
AA seq 428 aa AA seqDB search
MTAQHQTPLRFITAGSVDDGKSTLIGRLLYDSKALLSDQIKTLESGKSKGLKEAIDFSIL
TDGLEAEREQGITIDVAYRYFSTAKRKFIIADTPGHEQYTRNMVTGASTASAAVVLVDAS
QLDFGAQPLQLLPQTKRHSAILRQLNCPHIVVAVNKMDLLDYSEDKFNAIVEAYRRLAEQ
LGLKDAHFVPMSALLGDNIVYPGGNMPWYKGEPLLSILETLPGADEVSRTADDFYFPVQL
VVRQDADKADDFRGYQGRIERGSVAVGQTVRIEPNGLTAEVSEIITPKGEVAQAFAGEAA
TLRLDRDIDVSRGDLFVDKNSPLAPQKHLEATLCWFDERPLNTARKYLLKHGTQTVPAKV
GEIESVLDVRTLEQEAGAESLKMNDIAKVRINLQKPVTATPYAENTAAGSFILIDEATYG
TVAAGMIL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacggcacaacaccaaaccccgctccgcttcattaccgccggcagcgtcgatgacggc
aaaagcaccctgatcggacgactgctctacgacagcaaagccctgctgtccgaccaaatc
aaaaccttggaatccggcaaaagcaaaggtttgaaagaagccatagacttctccatcctg
accgacggactggaagccgaacgcgaacagggcattacgatcgatgtggcataccgctat
ttttccacggcgaaacggaaattcatcatcgccgacacgccggggcacgaacaatacacg
cgcaatatggttacgggcgcaagcaccgcttcggcggcagtcgtgctggttgacgcatcc
caactggatttcggcgcgcagcccttgcagcttctgccgcagaccaaacgccattccgcc
atcctccgccaactcaactgcccgcatattgtggtggcggtcaacaaaatggacctgctg
gattacagcgaagacaaattcaacgccattgtggaggcataccgccgacttgccgaacag
ctcggtttgaaagacgcgcatttcgtaccgatgtccgcactcttgggcgacaacattgtt
taccccggcggcaatatgccttggtataaaggcgaacccttattgtccattttggaaacc
ctgccgggggcggacgaagtcagccgcaccgccgacgatttttatttccccgtgcaactg
gtcgtccgccaagatgccgacaaggccgatgatttccgaggctatcaggggcgcatcgaa
cgcggttcggtcgccgtcgggcaaaccgtccgcatcgaaccgaacgggctgaccgccgaa
gtgtccgaaatcatcacgccgaaaggggaagtggcgcaggcttttgccggcgaggcggca
accctccggctggaccgcgacatcgatgtttcgcgcggcgacctttttgtcgataaaaat
tccccgctcgccccgcaaaaacatctggaagccacgctttgctggtttgacgaacgtccg
ctcaacaccgcgcgcaaatacctgctcaagcacggcacgcaaaccgtgccggcaaaagtc
ggggaaattgaaagcgttttggatgtccgcacgctggaacaagaggccggcgcggaatcc
ttgaagatgaacgacatcgccaaagtccgcatcaaccttcaaaaacccgttacggcaacg
ccttatgcggaaaacaccgccgccggttcgtttatcctgatagacgaagcgacatacggc
actgttgcggcaggtatgattttatga

DBGET integrated database retrieval system