KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1201Help
Entry
NMB1201           CDS       T00027                                 

Gene name
guaB
Definition
(RefSeq) inosine 5'-monophosphate dehydrogenase
  KO
K00088  
IMP dehydrogenase [EC:1.1.1.205]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB1201 (guaB)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     NMB1201 (guaB)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NMB1201 (guaB)
  Exosomal proteins of breast cancer cells
   NMB1201 (guaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1205024..1206487)
Genome map
AA seq 487 aa AA seqDB search
MRIVEKAYTFDDVLLVPAHSTVLPRDVKLQTKLTREITLNLPLLSAAMDTVTEARLAISM
AQEGGIGIIHKNMPPEMQARAVSKVKRHESGVVKDPVTVAPTTLIREVLEMRAQRKRKMS
GLPVVENGKVVGIVTNRDLRFENRVDLPVSAIMTPRERLVTVPEGTSIDEARELMHTHKV
ERVLVLNEKDELKGLITVKDILKTTEFPNANKDSEGRLRVGAAVGTGGDTEERVKALVEA
GVDVIVVDTAHGHSQGVIDRVRWVKETYPHIQVIGGNIATAKAALDLVAAGADAVKVGIG
PGSICTTRIVAGVGVPQLTAIHNVAEALKGTGVPLIADGGIRFSGDIAKALAAGAYSVML
GGMFAGTEEAPGEIELYQGRSYKSYRGMGSLGAMSQGSADRYFQDKTDSTDKYVPEGIEG
RVPYKGPIVNIIHQLTGGLRSSMGYLGCANIAEMHEKAEFVEITSAGMSESHVHDVQITK
EAPNYHR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcgtagaaaaagcctatactttcgacgatgttttgttggttcccgcacattcg
accgtgctgccgcgagacgttaaacttcaaaccaagctcacccgcgaaatcacactcaac
ctccccctgctttccgccgcgatggacactgttaccgaggcgcgcctcgccatttcgatg
gcacaagaaggcggcatcggcatcatccataaaaacatgccgcccgaaatgcaggcgcgc
gccgtttccaaagtgaaacgccacgaaagcggcgtggtcaaagaccccgtaaccgttgca
ccgacaacgctcatccgcgaagtcttggaaatgcgtgcgcagcgcaaacgcaaaatgtcc
ggcctgcccgtcgttgaaaacggcaaagtcgtcggcatcgtaaccaaccgcgacctgcgt
tttgaaaaccgcgtcgatttgcccgtttccgccattatgaccccgcgcgaacgtctggtt
accgtccccgaaggcacaagcatagacgaagcgcgcgaactgatgcacacgcacaaagtc
gagcgcgttttggttctgaacgaaaaagacgaactcaaaggtctgattaccgtcaaagat
attttaaaaaccaccgagtttcccaatgccaacaaagactccgaaggccgtctgcgcgtc
ggtgcggcagtcggcaccggcggcgacaccgaagagcgcgtcaaagccttggttgaggcc
ggcgtggacgtgattgtcgtcgataccgcccacgggcacagccaaggcgtgatcgaccgc
gtgcgttgggtcaaagaaacctatccgcacatccaagtcatcggcggcaacatcgccact
gccaaagccgctttggatttggtcgccgccggcgcggatgccgtcaaagtcggtatcggt
ccgggatcgatttgcaccacccgtatcgtggcaggtgtcggcgtgccgcaactgaccgcc
attcacaacgttgccgaagccctcaaaggcacgggcgttccgctgattgccgatggcggc
atccgcttctccggcgacatcgccaaagccctcgccgcaggcgcgtacagcgtcatgctc
ggcggtatgtttgcaggcacggaagaagcgccgggcgaaatcgaactctaccaaggccgc
tcatacaaatcctatcgcggtatgggttccttgggcgcgatgagccaaggttctgccgac
cgctacttccaagacaaaaccgacagcaccgacaaatacgtccccgaaggcatcgaaggc
cgcgttccttacaaaggcccgattgtgaacatcatccaccaactgaccggcggactgcgc
tccagcatggggtatttgggttgcgccaatattgccgaaatgcacgaaaaagcagaattt
gtggaaatcacttccgcaggtatgagcgaatcgcacgttcacgacgttcaaattaccaaa
gaagcaccgaactaccatcgctga

DBGET integrated database retrieval system