KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1228Help
Entry
NMB1228           CDS       T00027                                 

Gene name
metM
Definition
(RefSeq) homoserine dehydrogenase
  KO
K00003  
homoserine dehydrogenase [EC:1.1.1.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB1228 (metM)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB1228 (metM)
   00270 Cysteine and methionine metabolism
    NMB1228 (metM)
   00300 Lysine biosynthesis
    NMB1228 (metM)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     NMB1228 (metM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1233183..1234490
Genome map
AA seq 435 aa AA seqDB search
MKPVNIGLLGLGTVGGGTAAVLRDNAEEISRRLGREIRISAVCDLSEEKARQTCPSAAFV
KDPFELVAREDVDVVVELFGGTGIAKDAVLKAIENGKHIVTANKKLLAEYGNEIFPLAEK
QNVIVQFEAAVAGGIPIIKALREGLAANRIKSIAGIINGTSNFILSEMREKGSAFADVLK
EAQALGYAEADPTFDIEGNDAGHKITIMSALAFGTPMNFSACYLEGISKLDSRDIKYAEE
LGYRIKLLGITRKTGKGIELRVHPTLIPESRLLANVNGVMNAVRVNADMVGETLYYGAGA
GALPTASAVVADIIDIARLVEADTAHRVPHLAFQPAQVQAQTILPMDEITSSYYLRVQAK
DEPGTLGQIAALLAQENVSIEALIQKGVIDQTTAEIVILTHSTVEKHIKSAIAAIEALDC
VEKPITMIRMESLHD
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaagccagtaaacatcggtcttttaggtttgggtacggtcggcggcggtacggctgcc
gtgttgcgggacaacgcggaggaaatttcccgtcgcttggggcgcgaaatccgtatttct
gccgtgtgcgatttgagtgaagaaaaagcccgacaaacctgcccgtccgcagcctttgtc
aaagatccgttcgaactggtcgcacgtgaagacgtcgatgtcgtcgtcgaattgttcggc
ggtaccggcattgccaaagatgcggtgttgaaagccattgaaaacggcaaacacatcgtt
accgccaacaaaaaactgctcgccgaatacggcaacgaaatcttcccgctggcggaaaaa
caaaacgtcatcgtccaatttgaagcggcagtagcgggcggtatcccaatcatcaaagcc
ctgcgcgaaggtttggcggcaaacaggattaaatccatcgccggcattattaacggcacc
agcaacttcatcctctccgaaatgcgcgaaaaaggcagcgcgtttgccgatgtactgaaa
gaagcgcaggcattgggttatgccgaagccgatccgaccttcgacatcgaaggcaacgat
gcgggccataaaatcaccatcatgagcgcactggcattcggcacgccgatgaacttttcc
gcctgctacctcgaaggcatcagcaaactcgacagccgcgacatcaaatacgccgaagaa
cttggctatcgcatcaaactgttgggcattacccgcaaaaccggcaaaggcatcgagctg
cgcgtccaccctaccctgattcccgaaagccgcctcttggcaaacgtcaacggcgtgatg
aacgccgtgcgcgtcaacgccgatatggttggcgaaaccttatattacggcgcgggcgcg
ggcgcattgccgaccgcttccgccgtggttgccgatatcatcgacatcgcccgcctggtt
gaagccgataccgcccaccgcgtaccgcatctggcgttccaacccgcgcaagtccaagcg
caaaccatcctgcctatggacgaaattaccagcagctactacctgcgcgtccaagccaaa
gacgaaccgggcacgctggggcaaatcgccgcgctgttggcacaagaaaacgtgtccatc
gaagcactgattcaaaaaggcgtgattgatcagaccactgccgaaatcgtgattctgacc
cacagcacggtcgaaaaacacatcaagtcggcaatcgcagccatcgaagcactggattgc
gtggaaaaaccgattaccatgatccgcatggaaagcctgcatgactga

DBGET integrated database retrieval system