KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1237Help
Entry
NMB1237           CDS       T00027                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nme00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NMB1237 (recR)
DNA repair and recombination proteins [BR:nme03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NMB1237 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1243558..1244178)
Genome map
AA seq 206 aa AA seqDB search
MMSHKKQDAFQGLIDALKVLPNVGPKSAQRIAYHLLQHKRKEAEKLVDALQTALKQVYHC
AMCNTFCEGGLCDICADETRDGRRLMVVHMPADVSNMEAANCHDGLYFVLMGQINTALGM
DVSAIALDRLAQRLGGGEVEEIIIATAFTAEGNATAYVLSEFFKNLPYKVSRLSQGIPLG
GELEYVDAGTLAQAVYERRLIKEGGA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatgagccacaaaaaacaagatgccttccaaggattgatcgacgcgctgaaggtttta
cccaacgtcgggccgaaatcggcacagcggatagcgtatcatttgctccaacacaagcgc
aaagaggctgaaaaactggtggatgccttgcagacggcattgaagcaggtttaccattgc
gcgatgtgcaacacgttttgcgaaggcggattgtgcgatatttgtgccgatgaaacacgc
gacgggcggcggctgatggtggtgcatatgcctgccgacgtgtcgaatatggaagcggca
aactgccacgacgggctgtatttcgtcctgatggggcaaatcaatacggcattgggaatg
gacgtatccgccatcgcattggacaggctggcgcaacggctgggcggcggggaagtcgaa
gaaatcattattgcaaccgcttttaccgcagaaggcaatgcgacggcgtatgtcctgtcc
gagttttttaaaaacctgccttacaaagtcagcaggctgtcgcagggcattcccttgggc
ggcgaattggaatatgtcgatgcgggaacgctggcgcaggcggtgtacgaacgccgcctg
attaaagaaggcggggcataa

DBGET integrated database retrieval system