KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1244Help
Entry
NMB1244           CDS       T00027                                 

Gene name
rpe
Definition
(RefSeq) ribulose-phosphate 3-epimerase
  KO
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB1244 (rpe)
   01230 Biosynthesis of amino acids
    NMB1244 (rpe)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB1244 (rpe)
   00040 Pentose and glucuronate interconversions
    NMB1244 (rpe)
Enzymes [BR:nme01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     NMB1244 (rpe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1250984..1251712)
Genome map
AA seq 242 aa AA seqDB search
MTTYRIAPSILSADFARLGEEVESVIAAGADLIHFDVMDNHYVPNLTFGPMVCAALKPYA
SVPIDVHLMVEPVDDLIQSFAKAGASIITFHPEASRHIDRSLSLIRDMGCQAGLVLNPAT
PVYLLENVLDRLDMVLLMSVNPGFGGQSFIPHTLEKIRRVRAMLDRYEAQSGRHIAIEVD
GGIKTDNIAAVARAGADTFVAGSAIFGKPDYKAVIDAMRAELEKSGRLNLAPMIEIEMPS
EN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactacttaccgtatcgcacccagcattttatcggcagactttgcccgcctcggagaa
gaggtggaaagcgtcattgcggcaggtgcagatctgatccattttgacgtgatggacaac
cattatgtgccgaacctgaccttcggccctatggtttgcgcggcgttgaagccttatgca
agcgtgccgattgatgtgcatctgatggtcgaacccgttgacgacctgattcagtcgttt
gccaaagcaggagcatcaatcatcacgttccatcccgaggcgagccgccatatcgaccgc
agcttgagcctgattcgtgatatgggctgtcaggcggggctggtgttgaatccggcaacg
cccgtatatctgttggaaaacgtattggacaggctggatatggttttgctgatgtcggtc
aaccccggattcggcggacaaagcttcatcccgcacacccttgaaaaaatccgccgggtg
cgggcgatgctggatcggtacgaagcacaaagcgggcggcacatcgccatcgaagtggac
ggcggcatcaaaaccgacaatattgccgccgttgcccgagctggtgcggatacctttgtt
gccggttctgcgattttcggcaaaccagactataaggcggtgattgatgcgatgagggcg
gaactggaaaaaagcggcaggctgaaccttgcgccaatgattgaaatagaaatgccgtct
gaaaattag

DBGET integrated database retrieval system