KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1247Help
Entry
NMB1247           CDS       T00027                                 

Gene name
ribE
Definition
(RefSeq) riboflavin synthase subunit alpha
  KO
K00793  
riboflavin synthase [EC:2.5.1.9]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NMB1247 (ribE)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.9  riboflavin synthase
     NMB1247 (ribE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1253340..1253957)
Genome map
AA seq 205 aa AA seqDB search
MFTGIVQGLGKLTAIHRPSEAFHTYVVELPQEAADNLQRGASVANNGCCLTITEIEGNRV
SFDLMAETLAKTNLGLLKEGDCVNIERAARFGDEIGGHVMSGHIMATVPIVEIERDGFNR
TVWFSLPHELKPYILTKGFVGLDGCSLTIGKVEDGRFNVHLIPETLERTLFGSRKVGDRI
NIEIDPNTQAIVDTVERLMAQRYAK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtttacaggcattgttcaaggattgggaaaactgacggcaatccaccgcccgtcggag
gcatttcacacttatgtcgtcgagcttccgcaagaggcggcggacaatctgcaacgcggc
gcatcggtcgccaataacggctgctgcctgacgattaccgaaatcgaaggaaaccgcgtc
agtttcgatttaatggcggaaactttggcaaaaaccaatttggggctgctgaaggaaggc
gattgcgtcaacatcgaacgggcggcgcgtttcggagacgaaatcggcggacacgtcatg
agcggacacattatggcaaccgtgcctattgtcgaaatcgaacgggacgggttcaaccgc
acggtttggttttcgctcccgcatgaactcaaaccctatatcctgaccaaagggttcgtc
ggcttggacggttgcagcctgaccataggcaaagtcgaagacggccgtttcaatgtccat
ctgattcccgaaactttggaacggacgctgttcggcagcagaaaggtcggcgacaggatc
aacatcgaaatcgatccgaatacgcaggcaatcgtcgataccgtcgaacggctgatggcg
caaagatatgcaaagtga

DBGET integrated database retrieval system