KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1252Help
Entry
NMB1252           CDS       T00027                                 

Gene name
purM
Definition
(RefSeq) phosphoribosylaminoimidazole synthetase
  KO
K01933  
phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB1252 (purM)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     NMB1252 (purM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1258918..1259952)
Genome map
AA seq 344 aa AA seqDB search
MSTSLSYRDAGVDIDAGDQLVENIKPFAKRTMRPEVLGDLGGFGALVEIGKKYQNPVLVS
GTDGVGTKLKLAFDWDKHDTVGIDLVAMSVNDILVQGAEPLFFLDYFACGKLDVPRATDV
IKGIAQGCEESGCALIGGETAEMPGMYPVGEYDLAGFAVGVVEKENVITGRSIGVGDVVL
GLASNGAHSNGYSLIRKIIERDNPDLDAEFDNGKTLREAVIAPTRLYVKPILAALEKFTI
KGMAHITGGGITENVPRVLPENTVAQIDAKSWELPKLFQWLQKAGNVETQEMYRTFNCGI
GMVVIVAAEDADAVQGLLGEQGETVYRLGLIRERQGDEHQTQVA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagtacttcattgagttaccgcgatgcaggtgtcgatatcgacgcaggcgaccaactg
gtcgaaaacatcaaaccgtttgccaaacgcacgatgcgcccggaagtattgggggatttg
ggcggttttggcgcattggtcgaaatcggcaagaaatatcaaaatcccgtattggtcagc
ggtacggacggcgtgggtaccaagctcaagcttgcctttgattgggataaacatgatacg
gtcggcatcgaccttgttgcaatgagtgtcaacgatattttggttcaaggggctgagccc
ttgtttttcttggactattttgcctgcggtaaattggatgttccgcgcgcgaccgatgtt
attaaaggcattgcccaaggttgcgaagaatccggttgcgccctgattggcggggaaact
gccgaaatgccgggtatgtatcccgtcggagaatacgatttggcgggttttgccgtcggc
gtggtggaaaaagagaatgtcattaccggccgcagcatcggcgtaggcgatgtggtattg
ggtttggcttccaacggcgcacattcaaacggctattcccttatccgtaaaatcatcgaa
cgcgacaatcccgatctggatgccgagtttgataatggcaaaaccttgcgggaggctgtt
attgcgccgacccgtctgtatgtgaaaccgattcttgccgctttggaaaaatttaccatt
aaaggtatggcacacattaccggcggcggcattaccgaaaacgtgccgcgcgtgttgcct
gaaaacacggttgcacaaatcgatgctaaatcgtgggaattgcccaagctcttccaatgg
cttcaaaaggcgggcaatgtggaaacccaagaaatgtaccgaacctttaactgcggcatc
ggcatggtcgttattgttgctgccgaagatgccgatgcggttcagggtctcttgggtgaa
caaggtgaaacagtttaccgtttaggtttgatccgtgagcgtcagggagacgagcatcaa
acccaggttgcctga

DBGET integrated database retrieval system