KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1256Help
Entry
NMB1256           CDS       T00027                                 

Gene name
ribA_B
Definition
(RefSeq) 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  
3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NMB1256 (ribA_B)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     NMB1256 (ribA_B)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     NMB1256 (ribA_B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1263766..1264857
Genome map
AA seq 363 aa AA seqDB search
MSHISPIPEILADIKAGKMVIITDAEDRENEGDLLMAAQFVTPEAINFMIKHARGLVCLP
MDGEMVEKLGLPMMTQKNGAQYGTNFTVSIEAAHGITTGISAADRALTIQTAVSPTAKPE
DIVQPGHIFPLRAQKGGVLVRAGHTEAGVDLAQMNGLIPASVICEIINDDGTMARMPELM
KFAEEHKLKIGTIADLIEYRSRTESLLEDMGNAPVQTPWGEFQQHVYVDKLSGETHLALV
KGTPAADTETLVRVHEPFSVMDFIQANPRHSWSLPKALEHIQQAESGVVILLHRTEDGAS
LLDRTLPKGANQAYKWDSKSYGIGAQILAGLNVKKLRVLGQPSSFTGLTGFGLEVVGFEE
AEK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatatctcccccatccccgaaatcctagccgacatcaaagccggcaaaatggtc
atcatcaccgatgccgaagaccgagaaaacgaaggcgacctgctgatggcggcgcaattc
gtcacgcccgaagccatcaacttcatgatcaaacacgcgcgcggcttggtctgcctgccg
atggacggcgaaatggtcgaaaaactcgggctgccgatgatgacccaaaaaaacggcgcg
caatacggcaccaactttaccgtctccatcgaagccgcacacggcattaccaccggcatt
tccgccgccgaccgcgccctgactattcaaaccgccgtttccccgaccgctaaacccgaa
gacatcgtccaacccggtcatatctttccgcttcgcgcccaaaaaggcggcgtactcgtc
cgcgccggacacaccgaagccggcgtcgacctggcgcaaatgaacgggctgattcctgcc
tccgttatttgcgaaatcatcaacgacgacggcacgatggcgcgtatgcccgaactgatg
aaattcgccgaagaacacaagctcaaaatcggcacgattgccgacctcatcgaataccgc
agccgtaccgaaagcctgcttgaagacatgggcaatgcgcctgtacaaaccccgtggggc
gagttccaacaacacgtttacgtcgacaaactctccggcgaaacccacctcgccctcgtc
aaaggcacgcccgccgccgacaccgaaaccctcgtccgcgtccacgaacccttcagtgtg
atggacttcattcaagccaacccgcgccattcatggtcgctgcccaaagcccttgagcac
atccaacaagccgaaagcggcgtcgtcatcctcttacaccgcaccgaagacggcgcatcc
ctgctcgaccgaaccctacccaaaggcgcaaaccaagcctacaaatgggacagcaaaagc
tacggcatcggcgcacaaatcctcgccggcctcaacgtcaaaaaactgcgcgtcctcggg
cagccctcatctttcaccggcctgaccggcttcggtttggaagtcgtcggctttgaagaa
gcggaaaaataa

DBGET integrated database retrieval system