KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1268Help
Entry
NMB1268           CDS       T00027                                 

Definition
(RefSeq) hypothetical protein
  KO
K00865  
glycerate 2-kinase [EC:2.7.1.165]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Glycerolipid metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NMB1268
  Lipid metabolism
   00561 Glycerolipid metabolism
    NMB1268
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB1268
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     NMB1268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1277271..1278386)
Genome map
AA seq 371 aa AA seqDB search
MKIVIAPDSFKESLTAQQVAEAIKRGFQQSIADVECLLCPVGDGGEGTVDAIRHSLDLEE
KCLQVTGPFGQKEVMRYFQKEQLALFEVADLVGLGKIPLEKRNPLQIQTRGIGELIRHLI
SQEIKEIYIGVGGTASNDGGIGIAAGLGYQFYDEDGNALPVCGQSLLNLASVSTENRYEI
PEDVHIRILADVVSPLCGHQGATYTFGKQKGLDSTMFEAVDQAIQDFYEKVSPATLKLKG
AGAGGGIAGGLCAFAQASIVSGIDTCLDLIDFDKKVSDVDLVIVGEGRLDRQSLAGKAPI
GVAKRTPVGVPVVAICGSLVEDLPSLPFENIQAAFSILEKSEPLEDSLKNASLYLEHTAS
NIGHLLNMPKI
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgtaattgcaccggattcgtttaaggaaagcttgacagctcaacaggtagct
gaagcaataaaaagaggcttccaacaatcgatagcagatgtggaatgtctcctctgtcct
gtcggtgatgggggagaaggcactgtagatgctatccgacattctcttgacctagaagaa
aaatgtctccaagtgacaggaccttttggacaaaaagaagtcatgcgctattttcaaaaa
gaacaactagccctattcgaagttgctgatttggttggtcttggaaaaatcccgctagag
aaacgaaatccattacaaatccaaactcgtggtattggagaattgattcgccacctcatt
agtcaagaaattaaagaaatctatattggcgttggcggtacggccagtaatgatggaggt
attgggattgctgctggtttaggttatcaattttatgatgaggatggaaatgccttaccc
gtttgcggtcaatccttactaaacctagcttctgtttcaacagaaaatcgctatgaaatt
cctgaagatgttcacattcgtattttagcagatgttgtgagtcccttatgtggacaccaa
ggtgcgacctatacgtttggcaagcaaaaagggttggattctactatgtttgaggccgta
gatcaggcaatacaagatttttatgaaaaagtctcccctgcaacattaaaacttaaagga
gcaggagctggtggaggcatcgctggtggtttgtgcgcctttgctcaggcaagtatcgta
tctggaattgacacctgcctggacttgattgactttgataagaaagtgtcagatgttgac
ttggttatcgttggtgaaggaagactagatcgtcaaagtttagcagggaaagcgcctatt
ggtgtagcaaaaagaacccctgtcggagttcctgttgtcgctatttgtggcagtctcgtt
gaagatttgccttccctgccatttgaaaatatccaagctgccttttctattttggagaaa
agtgaacctttagaagatagtttgaaaaatgccagcctctatttggagcatacggcttct
aatattggacacttattaaatatgcctaagatttag

DBGET integrated database retrieval system