KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1271Help
Entry
NMB1271           CDS       T00027                                 

Definition
(RefSeq) mercury transport periplasmic protein
  KO
K07213  
copper chaperone
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1281410..1281622)
Genome map
AA seq 70 aa AA seqDB search
METLILDIGGMSCGGCVKSVTRILEGVKGVASVEVSLENKSATVGYDPAQTDAGALIEAV
EDGGYDAALK
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atggaaacccttatcctcgacatcggcggcatgagctgcggcggctgcgtcaaaagcgtt
acccggatattggaaggcgtaaaaggcgtggcaagcgtcgaagtcagccttgaaaacaaa
agtgcgaccgtcggatacgaccccgcgcaaaccgatgcaggggcgttgattgaagccgtt
gaagacggcggctatgatgccgcgttgaaataa

DBGET integrated database retrieval system