KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1274Help
Entry
NMB1274           CDS       T00027                                 

Definition
(RefSeq) hypothetical protein
  KO
K09795  
uncharacterized protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1283700..1284683
Genome map
AA seq 327 aa AA seqDB search
MKNFLSLFSSILMSALIAVWFSQNPINAYWQQTYHRNSPLEPLAAYGWWRSGAALQENAY
ALSDGIKAFLSGETPPTAQDGGSADMPSEAAASEAVPQTGETEWKQDTEAAAVRSGDKVF
FVGDSLMQGVAPFVQKSLKQQYGIESVNLSKQSTGLSYPSFFDWPKTIEETLQKHPEISV
LAVFLGPNDPWDFPVGKLYLKFASDEWAQEYLKRVDRILEAAHTHRVQVVWLGIPYMKKA
KLDGQMRYLDKLLSEHLKGKIILIPTTHTLSGGKDRYTDSVNVNGKPVRYRSKDGIHFTA
EGQKLLAAKIMEKIVFEPSTQPSSTQP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactttctttcccttttctcctccatactgatgtctgccctgattgccgtgtgg
ttcagccaaaaccccatcaacgcctactggcagcagacctaccaccgcaacagcccgctc
gaaccgcttgccgcctacggatggtggcggagcggtgcggcgttgcaagaaaacgcctac
gccctttcagacggcatcaaagccttcctgtccggcgaaacgccgccgacggctcaagac
ggcggttcggcagatatgccgtctgaagccgccgcatccgaagccgtccctcaaaccggt
gaaacagaatggaaacaagacaccgaagccgccgccgtccgcagcggcgacaaagtcttt
tttgtcggcgactcgctgatgcagggcgttgcccccttcgtgcaaaaaagcctgaaacag
caatacggcatcgaatccgtcaacctcagcaaacaaagcacggggctgtcctacccctca
ttcttcgactggccgaaaacgattgaagaaaccctgcaaaaacatcccgaaatcagcgta
ctcgccgtcttcctcggaccgaacgacccgtgggatttccccgtcggcaaactctatctc
aaattcgcttccgacgaatgggcgcaagaatacctgaaacgtgtcgaccgcatccttgaa
gccgcacacacgcaccgcgtccaagtcgtctggctcggcatcccctacatgaaaaaagcc
aagctcgacggacagatgcgctacctagacaaactgctttcggaacatttgaaaggcaaa
atcatcctgattcccaccacgcacaccctgagcggcgggaaagaccgctacaccgactcc
gtcaacgtcaacggcaaacccgtccgctaccgcagcaaggacggcatacactttaccgcc
gaaggacaaaaactgctggcggcaaaaataatggaaaaaatcgtttttgaaccaagtacg
caaccatcaagtacacagccatga

DBGET integrated database retrieval system