KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1276Help
Entry
NMB1276           CDS       T00027                                 

Gene name
fadD-1
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase
  KO
K01897  
long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Fatty acid biosynthesis
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Quorum sensing
Module
beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NMB1276 (fadD-1)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    NMB1276 (fadD-1)
   00071 Fatty acid degradation
    NMB1276 (fadD-1)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    NMB1276 (fadD-1)
Enzymes [BR:nme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     NMB1276 (fadD-1)
Lipid biosynthesis proteins [BR:nme01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   NMB1276 (fadD-1)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   NMB1276 (fadD-1)
  Exosomal proteins of breast cancer cells
   NMB1276 (fadD-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1286160..1287713
Genome map
AA seq 517 aa AA seqDB search
MNRTYANFYEMLAAACRKNGNGTAVFDGKEKTAYRALKQEAEAVAAYLQNIGVKFGDTVA
LAVSNSTEFITAYFAISAIGAVAVPMNTFLKNSEYAYILNDCKARFLFASAGLSKELAGL
KAQTPVEKIIWTDKSRPTGETAEGDAFFEDVRRFPEKPDLGRQPRINDLAHIIYTSGTTG
HPKGALISYANLFANLNGIERIFKISKRDRFIVFLPMFHSFTLTAMVLLPIYMACSIILV
KSVFPFSNVLKQTLLKRATVFLGVPAIYTAMSKAKIPWYFRWFNRIRLFISGGAPLAEQT
ILDFKAKFPRAKLLEGYGLSEASPVVAVNTPERQKARSVGIPLPGLEAKAVDEELVEVPR
GEVGELIVRGGSVMRGYLNMPAATDETIVNGWLKTGDFVTIDEDGFIFIVDRKKDLIISK
GQNVYPREIEEEIYKLDAVEAAAVIGVKDRYADEEIVAFVQLKEGMDLGENEIRRHLRTV
LANFKIPKQIHFKDGLPRNATGKVLKRVLKEQFDGNK
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggacttatgccaatttctacgaaatgctcgccgccgcctgccgcaaaaacgga
aacggcacggcagtgttcgacggcaaggaaaaaaccgcctaccgcgcgctcaagcaggag
gccgaagccgtcgcggcgtatctgcaaaatatcggcgtgaagttcggcgacacggtcgcg
ctggcggtttccaattccacagaatttattaccgcctatttcgccatctccgccatcggc
gcggtcgccgtaccgatgaacacatttttgaaaaacagcgaatacgcgtatatcctgaac
gactgcaaggcgcgcttcctgttcgcctcggccggcctgtcaaaagaattggcgggcttg
aaggcgcaaacgcccgtcgaaaaaatcatttggacggacaaaagccgtccgaccggcgaa
acggcggaaggcgatgccttttttgaagacgtgcgccgcttccccgaaaaacccgacttg
ggccgccaaccccggataaatgatttggcacacatcatctacacctccggcacgacgggg
catcccaaaggcgcgctaatcagttacgccaacctgttcgccaacctgaacggcatcgaa
cgcatctttaaaatttccaagcgcgaccgctttatcgttttcctgccgatgttccacagc
ttcacgctgacggctatggtgctgctgccgatttatatggcgtgttcgattattttggtc
aaatccgtttttccgttttccaacgttttgaaacagacactgctcaaacgcgcgaccgtg
tttttgggcgtacccgcgatttacaccgcgatgagcaaggcgaaaatcccttggtatttc
agatggttcaaccgcattcgcctgtttatcagcggcggcgcgcctttggcggaacaaacc
atcctcgatttcaaagccaagttcccccgcgccaaattgctggaaggctacggactgagc
gaagcctctcccgtcgtcgccgtcaatacgcccgagaggcaaaaagcccgcagcgtcggc
atccccctgcccggtttggaagccaaagccgtcgatgaagaattggtcgaagtgccgcgc
ggcgaagtgggcgaactgatcgtcaggggcggttcggtgatgcggggctacctcaatatg
cctgccgccaccgatgaaaccatcgtcaacggctggttgaaaacgggcgatttcgttacc
atagacgaagacggctttatctttatcgtcgaccgcaaaaaagatttgattatttccaaa
ggtcaaaatgtctatccgcgcgagattgaagaagaaatctacaaactcgatgccgtcgaa
gccgccgccgtcatcggcgtgaaagaccgttatgccgacgaggaaatcgtcgccttcgtc
caattgaaggaaggtatggatttgggcgagaacgaaatccgccgccacctgcgtaccgtg
ctggcaaatttcaaaatccccaaacaaatccactttaaagacgggctgccgcgcaacgct
acgggcaaggtattgaaacgggtgttgaaggagcagtttgacggaaacaaatga

DBGET integrated database retrieval system