KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1279Help
Entry
NMB1279           CDS       T00027                                 

Definition
(RefSeq) membrane-bound lytic murein transglycosylase B
  KO
K08305  
membrane-bound lytic murein transglycosylase B [EC:4.2.2.-]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.-  
     NMB1279
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Peptidoglycan biosynthesis and degradation
  Lytic transglycosylase
   NMB1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1292248..1293357)
Genome map
AA seq 369 aa AA seqDB search
MKKRKILPLAICLAALSACTAMEARPPRANEAQAPRAVEMKKESRPAFDAAAVFDAAAVP
VSDSGFAANANVRRFVDDEVGKGDFSRAEWQDFFDKAAYKADIVKIMHRPSTSRPWYVFR
TGNSGKAKFRGARRFYAENRALIDDVAQKYGVPAELIVAVIGIETNYGKNTGSFRVADAL
ATLGFDYPRRAGFFQKELVELLKLAKEEGGDVFAFKGSYAGAMGMPQFMPSSYRKWAVDY
DGDGHRDIWGNVGDVAASVANYMKQHGWRTGGKMLVSATLAPGADVQAIIGEKTALTRTV
ADLKAYGIIPGEELADDEKAVLFKLETAPGVFEYYLGLNNFYTVWQYNHSRMYVTAVRDI
ANSLGGPGL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagaaaaatactgccgctggcaatttgtttggcggctttgtctgcctgtacg
gcgatggaggcacgcccaccccgggcaaatgaagcccaagccccccgcgcggttgaaatg
aaaaaagaaagccgccccgcgtttgacgcggcagccgtatttgacgcggcagccgtaccg
gtatccgacagcgggtttgccgccaatgcaaatgtccgccgttttgtggacgatgaagtc
gggaaaggggatttttcccgggcggaatggcaggatttttttgacaaagcggcttacaag
gcggacatcgtcaagattatgcaccgcccctccacatcgcgtccgtggtatgtgttccgc
acgggaaattcgggcaaggcgaaatttcgcggcgcgcgccggttttatgcggaaaaccgc
gcgcttatcgatgatgtggcgcaaaaatacggcgtgcctgccgaacttatcgtggcggtt
atcgggattgaaacgaattacggcaaaaatacgggcagtttccgtgtggcggacgcattg
gcgaccttaggctttgattacccccgccgcgccgggtttttccaaaaagaattggtcgag
cttttaaagctggcaaaagaagaaggcggcgatgttttcgcctttaaaggcagctatgcg
ggcgcaatggggatgccgcaatttatgccttcgagctaccggaaatgggcggtggattat
gacggggacggacatcgggacatatggggcaacgtcggcgatgtcgcggcatcggttgcc
aattatatgaagcagcacggttggcgcacgggcgggaaaatgctggtgtctgcaacattg
gcgccgggtgcggatgttcaggcaatcattggcgaaaaaaccgccctgacgcggacggtg
gcggatttgaaggcgtacggcatcatccccggcgaagagcttgcagatgatgaaaaggcg
gttttgttcaaactggaaaccgcaccgggcgtgtttgaatattatttgggcttgaacaat
ttttatacggtatggcagtacaaccacagccggatgtatgtaacggcggtcagggacatt
gccaattcgcttggcggcccgggattgtaa

DBGET integrated database retrieval system