KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1282Help
Entry
NMB1282           CDS       T00027                                 

Gene name
panD
Definition
(RefSeq) aspartate alpha-decarboxylase
  KO
K01579  
aspartate 1-decarboxylase [EC:4.1.1.11]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NMB1282 (panD)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NMB1282 (panD)
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     NMB1282 (panD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1299459..1299842
Genome map
AA seq 127 aa AA seqDB search
MFRTMLGGKIHRATVTEADLNYVGSITVDQDLLDAAGIYPNEKVAIVNNNNGERFETYTI
AGKRGSGVICLNGAAARLVQKGDIVIIMSYVQLSEPEIAAHEPKVVLVDGNNKIRDIISY
EPPHTVL
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtaccatgcttggcggaaaaatccaccgcgccaccgttaccgaagccgatttg
aactatgtcggcagtattaccgtcgatcaagacctgttagacgcggcaggcatctacccc
aacgaaaaagtcgccattgtcaacaacaacaacggcgaacgttttgaaacctataccatt
gcagggaaacgcggcagcggcgtgatttgtctgaacggtgctgcagccaggctggtacag
aaaggcgatatcgtcatcatcatgtcttacgtccaactctccgaacccgaaatcgccgca
cacgaacccaaagtcgtcttggtagacggaaacaacaaaatccgcgacatcatctcctac
gagccgccgcacaccgtgctgtaa

DBGET integrated database retrieval system