KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1285Help
Entry
NMB1285           CDS       T00027                                 

Gene name
eno
Definition
(RefSeq) phosphopyruvate hydratase
  KO
K01689  
enolase [EC:4.2.1.11]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB1285 (eno)
  Energy metabolism
   00680 Methane metabolism
    NMB1285 (eno)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    NMB1285 (eno)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     NMB1285 (eno)
Messenger RNA biogenesis [BR:nme03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     NMB1285 (eno)
Exosome [BR:nme04147]
 Exosomal proteins
  Proteins found in most exosomes
   NMB1285 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1301209..1302495
Genome map
AA seq 428 aa AA seqDB search
MSAIVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYS
GKGVLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVAR
AAAEDSGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALR
CGAEIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEALQLMVEATEAAGYKAGEDVLFA
LDCASSEFYKDGKYHLEAEGRSYTNAEFAEYLEGLVNEFPIISIEDGMDENDWEGWKLLT
EKLGGRVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYA
SVMSHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAADYPSK
AAFYQLGK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaatcgttgatattttcgcccgcgaaattttggactcacgcggcaaccccaca
gtcgagtgtgatgtattgctcgaatccggcgtaatgggacgcgcagccgtaccgagcggc
gcgtccaccggtcaaaaagaggctttggaacttcgcgacggcgacaaatcccgttattcg
ggcaagggcgtattgaaggcggtcgaacacgtcaacaaccaaatcgcccaagccctcatt
ggtatcgatgccaacgagcaatcttatatcgaccaaatcatgatcgaattggacggtact
gaaaacaaaggcaatttgggtgcgaatgcgactttggcggtttctatggcggttgcacgc
gccgctgccgaagactcaggcctgccgctttaccgctacttgggcggcgcaggcccgatg
tccctgcccgtaccgatgatgaacgtcatcaacggcggcgaacacgccaacaacagcctg
aacatccaagagtttatgattatgcccgtcggcgcaaaatctttccgcgaagcgttgcgc
tgcggtgcggaaattttccacgccttgaaaaaactgtgcgacagcaaaggcttcccgacc
acagtcggcgacgaaggcggtttcgcccccaacctgaacagccacaaagaagccctgcaa
ctgatggtcgaggcgaccgaagccgccggctacaaagcgggcgaagacgtattattcgca
ttggactgcgcctccagcgagttctacaaagacggcaaataccacttggaagccgaaggc
cgctcctacaccaacgcggaatttgccgaatatctggaaggcctggtcaacgagttcccc
atcatctccatcgaagacggcatggatgaaaacgactgggaaggctggaaactgctgacc
gaaaaactgggcggtagagttcaattggttggcgacgacttgttcgtaaccaatccaaaa
atcttggccgaaggcatcgaaaaaggcgtagcaaacgcattgctggtcaaagtcaatcaa
atcggtactttgagcgagaccctgaaagccgtcgacttagccaaacgcaaccgctacgcc
agcgtaatgagccaccgctccggcgaaaccgaagacagcaccattgccgacttggcagtc
gccaccaactgtatgcagatcaaaaccggttctttgagccgttccgaccgcatggcgaaa
tacaaccaactgctgcgtatcgaggaagaattggcggaagccgccgactaccccagcaaa
gccgcattctaccaactgggcaaataa

DBGET integrated database retrieval system