KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1285Help
Entry
NMB1285           CDS       T00027                                 

Gene name
eno
Definition
(RefSeq) phosphopyruvate hydratase
  KO
K01689  
enolase [EC:4.2.1.11]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB1285 (eno)
   01230 Biosynthesis of amino acids
    NMB1285 (eno)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB1285 (eno)
  Energy metabolism
   00680 Methane metabolism
    NMB1285 (eno)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    NMB1285 (eno)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     NMB1285 (eno)
Messenger RNA biogenesis [BR:nme03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     NMB1285 (eno)
Exosome [BR:nme04147]
 Exosomal proteins
  Proteins found in most exosomes
   NMB1285 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1301209..1302495
Genome map
AA seq 428 aa AA seqDB search
MSAIVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYS
GKGVLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVAR
AAAEDSGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALR
CGAEIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEALQLMVEATEAAGYKAGEDVLFA
LDCASSEFYKDGKYHLEAEGRSYTNAEFAEYLEGLVNEFPIISIEDGMDENDWEGWKLLT
EKLGGRVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYA
SVMSHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAADYPSK
AAFYQLGK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaatcgttgatattttcgcccgcgaaattttggactcacgcggcaaccccaca
gtcgagtgtgatgtattgctcgaatccggcgtaatgggacgcgcagccgtaccgagcggc
gcgtccaccggtcaaaaagaggctttggaacttcgcgacggcgacaaatcccgttattcg
ggcaagggcgtattgaaggcggtcgaacacgtcaacaaccaaatcgcccaagccctcatt
ggtatcgatgccaacgagcaatcttatatcgaccaaatcatgatcgaattggacggtact
gaaaacaaaggcaatttgggtgcgaatgcgactttggcggtttctatggcggttgcacgc
gccgctgccgaagactcaggcctgccgctttaccgctacttgggcggcgcaggcccgatg
tccctgcccgtaccgatgatgaacgtcatcaacggcggcgaacacgccaacaacagcctg
aacatccaagagtttatgattatgcccgtcggcgcaaaatctttccgcgaagcgttgcgc
tgcggtgcggaaattttccacgccttgaaaaaactgtgcgacagcaaaggcttcccgacc
acagtcggcgacgaaggcggtttcgcccccaacctgaacagccacaaagaagccctgcaa
ctgatggtcgaggcgaccgaagccgccggctacaaagcgggcgaagacgtattattcgca
ttggactgcgcctccagcgagttctacaaagacggcaaataccacttggaagccgaaggc
cgctcctacaccaacgcggaatttgccgaatatctggaaggcctggtcaacgagttcccc
atcatctccatcgaagacggcatggatgaaaacgactgggaaggctggaaactgctgacc
gaaaaactgggcggtagagttcaattggttggcgacgacttgttcgtaaccaatccaaaa
atcttggccgaaggcatcgaaaaaggcgtagcaaacgcattgctggtcaaagtcaatcaa
atcggtactttgagcgagaccctgaaagccgtcgacttagccaaacgcaaccgctacgcc
agcgtaatgagccaccgctccggcgaaaccgaagacagcaccattgccgacttggcagtc
gccaccaactgtatgcagatcaaaaccggttctttgagccgttccgaccgcatggcgaaa
tacaaccaactgctgcgtatcgaggaagaattggcggaagccgccgactaccccagcaaa
gccgcattctaccaactgggcaaataa

DBGET integrated database retrieval system