KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1291Help
Entry
NMB1291           CDS       T00027                                 

Gene name
nrdA
Definition
(RefSeq) ribonucleotide-diphosphate reductase subunit alpha
  KO
K00525  
ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB1291 (nrdA)
   00240 Pyrimidine metabolism
    NMB1291 (nrdA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     NMB1291 (nrdA)
DNA repair and recombination proteins [BR:nme03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    NMB1291 (nrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1306808..1309087)
Genome map
AA seq 759 aa AA seqDB search
MNTPTDLKVTKRDGRLEAIDLDKIHRVVTWAADGLENVSVSQVELKSHIQFYNGIRTDDI
HETIIKAAADLISEDTPDYQYLAARLAIFHLRKIAYGEYEPPHLYDHVKKLTDAGKYDRH
ILEDYSREEFDELNAYIDHERDMSFSYAAVKQLEGKYLVQNRVTRQIYETPQFLYVLVAM
CLFSKYPKEARLGYVKRFYDAVSTFKVSLPTPIMSGVRTPTRQFSSCVLIECDDSLDSIN
ATTSAIVKYVSQRAGIGINAGRIRGLDSEIRGGEARHTGCIPFFKMFQAAVKSCSQGGVR
GGAATLFYPLWHIEAESLLVLKNNRGVEDNRIRQLDYGVQINRLLYTRLIKGGNITLFSP
NEVPGLYEAFFADQDEFERLYTKYEQDPDIRKRIIPAADLFSTLMQERAGTGRIYIQNVD
HCNTHSPFDPRVAPVHQSNLCMEIALPTKPLDNINDPNGEIALCTLSAFNLGALNSLDEL
EGLADLTVRALDALLDYQGYPVEAARTSTMGRRSLGIGVINYAYYLAKNGVRYSDGSALG
LTHRTFEAIQYYLLKASANLAKEYGACTLFNQTVYSQGKLPIDTYKKDLDAVCGEPLHYD
WESLRAEIVKYGLRNSTLTALMPSETSSQIANATNGIEPPRGLVTVKASKDGILKQVVPE
FETLKNAYETLWQLPGNEGYLKLVGVMQKFVDQSISANTAYDPGKFEGGKVSMKQMLKDL
LTAYKYGVKTLYYHNTRDGADDTQTDIQDDGCAGGACKI
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaccgactgatttgaaagtaaccaaacgagacggaagattagaagccattgat
ttggataagattcaccgtgtcgtcacttgggcggcggacggattggaaaatgtttccgtg
tcgcaggtcgagttgaaatcgcacatccagttctacaacggcatccgcaccgacgacatc
cacgaaaccatcatcaaagccgctgccgatttaatttcggaagataccccggactaccaa
taccttgccgcgcgtttggcgattttccatcttcgtaaaatagcctacggcgagtacgag
ccgccgcacctttacgaccacgttaaaaaacttaccgatgccggaaaatacgacaggcat
atccttgaggattacagccgcgaagaatttgacgaactgaacgcctatatcgaccacgaa
cgcgatatgtccttttcctatgccgctgtcaaacagctcgaaggcaaatatctggtacag
aaccgcgttacccgccaaatttacgaaacgccgcagtttttatatgttttggtggcgatg
tgccttttcagcaaatacccgaaagaggcgcgcttgggttacgtcaaacggttttacgat
gccgtttctacatttaaagtatcgctgccgactccgattatgagcggcgtgcgtacgcct
acgcgccagttctcaagctgtgtgctgattgaatgcgacgatagtttggattccatcaat
gccactaccagcgcgattgtgaaatacgtttcccagcgtgcgggcatcggcatcaatgcc
ggacgtatccgcggtttggacagcgaaatccggggcggcgaagcgcggcataccggctgc
attcccttctttaaaatgtttcaggcggcggtcaaatcctgttcgcaaggcggcgtgcgc
ggcggcgcggcaaccttgttctaccccttgtggcatatcgaagccgaaagcctgctggtg
ttgaaaaacaaccgcggtgtggaagacaaccgtatccgtcagcttgattacggcgtgcaa
atcaaccgcctgctgtacacccgcctgattaagggcggcaacattacgctgttttcgccc
aacgaggttccgggattgtacgaagcgttttttgccgaccaagacgaatttgagcggctc
tatacgaaatacgagcaagaccctgatatccgcaagcgcatcattccggctgccgacctg
ttttccacgctgatgcaggagcgtgccggaaccgggcgcatctacattcaaaacgtcgat
cactgcaatacgcacagcccgttcgatccgcgcgtcgcgcctgttcatcagtccaacttg
tgtatggaaatcgccctgccgaccaaaccgctggacaatatcaacgatccgaacggcgaa
atcgccctgtgtacactgtctgcctttaacttgggcgcattaaacagcttggacgaattg
gaagggcttgccgacttgaccgttcgtgcgctcgatgcacttttagattatcagggatat
ccggtagaagccgcgcgtacctctactatgggccgccgttcgctcggcatcggcgtgatt
aactatgcttattatctggcgaaaaacggtgtccgctacagcgacggttccgcgctcggt
ctgacccaccgtacctttgaagccatacagtattacctgctcaaagcatcggcaaacctt
gccaaagaatacggtgcgtgcacgctctttaaccaaaccgtttattcgcaaggcaaactg
cccatcgacacttacaaaaaagatttggatgccgtctgcggcgagcctttgcattacgac
tgggaaagcctgcgtgccgaaatcgtcaaatacggcctgcgcaactctactctgaccgcg
ctcatgccgtctgaaaccagctctcaaatcgccaacgccaccaacggcatcgagccgccg
cgcggattggtaacggtcaaagcatcgaaagacggcattttgaaacaagtcgtgccggag
tttgaaaccctgaaaaatgcctatgaaaccctgtggcagcttcccggcaacgaaggctac
ctgaaacttgtcggcgtgatgcaaaaattcgtcgatcaatcgatttccgccaataccgcc
tacgacccgggcaaattcgaaggcggcaaagtttctatgaaacaaatgctcaaagacctg
ctgaccgcctacaaatacggcgtcaaaaccctgtactaccataacacccgcgacggtgcg
gacgatacgcagaccgatattcaggatgacggctgcgcgggcggggcttgtaagatttga

DBGET integrated database retrieval system