KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1304Help
Entry
NMB1304           CDS       T00027                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K00121  
S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB1304
   01220 Degradation of aromatic compounds
    NMB1304
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB1304
  Energy metabolism
   00680 Methane metabolism
    NMB1304
  Lipid metabolism
   00071 Fatty acid degradation
    NMB1304
  Amino acid metabolism
   00350 Tyrosine metabolism
    NMB1304
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NMB1304
   00626 Naphthalene degradation
    NMB1304
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NMB1304
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     NMB1304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1321440..1322576
Genome map
AA seq 378 aa AA seqDB search
MEMKQADSTIKSRAAVAFAPNQPLQIVEIDVEMPRKGEVLIRNTHTGVCHTDAFTLSGSD
PEGVFPVVLGHEGAGVVVAVGEGVSSVKPGDHVIPLYTAECGECEFCCSGKTNLCVSVRD
TQGKGLMPDGTTRFSYQGQPIYHYMGCSTFSEYSVVAEVSLAKINPEANHEQVCLLGCGV
TTGIGAVHNTAKVQEGDSVAVFGLGAIGLAVVQGARQAKAGRIIAIDTNPSKFELAKQFG
ATDCLNPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRQALESAHRGWGQSIIIGVAG
AGQEISTRPFQLVTGRVWKGSAFGGVKGRSELPKMVEDSMKGDIELEPFVTHTMTLDQIN
KAFDLMHEGKSIRAVIHY
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaaacaagccgattcaaccatcaaatctcgtgcggcggtggcattcgcccct
aaccaacccttacaaattgtggaaatcgacgtagaaatgccgcgtaaaggcgaggtgtta
atccgcaatacccacactggcgtgtgccatactgatgcgtttacgttatcaggaagcgat
cctgaaggcgtattccctgtggtgcttggacacgaaggtgcgggtgtggtcgttgctgtg
ggcgaaggtgtgtcaagcgtaaaaccgggtgatcacgtgattccgctttacaccgccgaa
tgtggcgaatgtgagttttgttgttcaggtaaaaccaacttgtgcgtctcagtgcgtgat
acacaaggtaaaggcttaatgccggacggcacgacgcgtttttcttatcaaggtcagcca
atctatcactatatgggctgttcgactttcagtgaatactccgttgttgccgaagtttca
ctggcgaaaatcaaccctgaagccaaccatgaacaagtatgtttgctcggctgcggcgtt
accacaggtattggtgcggtacataatacggcaaaagtgcaagaaggcgactctgttgcc
gtgtttggtttgggggcgattggtttggcggtggtgcaaggtgcgcgtcaagccaaagcc
ggccgcattatcgccattgataccaatccatcaaaatttgagttggcaaaacagttcggt
gcaacggattgtttgaacccgaacgattacgataaaccgatcaaagatgtgttgttagac
attaataaatggggcattgaccatacctttgaatgtatcggcaatgtaaacgtaatgcgt
caggcattagaaagtgcacatcgtggttggggtcaatccattatcatcggcgtagcaggt
gcaggacaagaaatttcaacgcgtccgttccagttggtaacaggtcgtgtttggaaaggt
tcagcatttggcggtgtgaaaggtcgctctgaactgccgaaaatggtggaagattcaatg
aaaggcgacattgagttagaaccgtttgtaacccacacaatgacactcgatcaaatcaat
aaagcctttgacttaatgcacgaaggtaaatcgatccgcgccgttattcactactaa

DBGET integrated database retrieval system