KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1310Help
Entry
NMB1310           CDS       T00027                                 

Gene name
ispG
Definition
(RefSeq) 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin)
  KO
K03526  
(E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC:1.17.7.1 1.17.7.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMB1310 (ispG)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.1  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (ferredoxin)
     NMB1310 (ispG)
    1.17.7.3  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin)
     NMB1310 (ispG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1327455..1328720
Genome map
AA seq 421 aa AA seqDB search
MNTLQRRKTHQVRIDHITVGSEAPVVIQSMTNTDTADAKATALQIKELSDAGSEMVRITV
NSPEAASKVAEIRRRLDDMGYATPLIGDFHFNGERLLAEFPECGKALSKYRINPGNVGKG
VKGDEKFAFMIRTAAENDKAVRIGVNWGSLDQSLAKRMMDANLASSAPKPPEEVTKEALI
VSALESAEKAVLLGLPEDKIILSCKVSAVQDLIQVYRELGSRCAYPLHLGLTEAGMGSKG
IVASTAALSVLLQEGIGDTIRISLTPEPGSPRTQEVVVGQEILQTMGLRSFTPMVTACPG
CGRTTSTVFQELAQDVQNYLRQKMSIWRTLYPGVESLNVAVMGCVVNGPGESKLADIGIS
LPGTGETPVAPVYVDGERKVTLKGDNIATEFLAIVEEYVKTNYGENGLKRHQGKVIPIHS
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaacacactccaacgccgcaagacgcatcaagtccgcatcgatcatattaccgtcggt
tcagaagcacccgtcgttatccaatctatgaccaacaccgacactgccgatgcaaaagcc
accgcattgcagattaaggaattgagcgatgccggatccgaaatggtgcgtattaccgtc
aacagccccgaagccgcgtccaaagttgccgaaatccgccgccgcttggacgatatgggc
tatgccacaccgcttatcggcgatttccacttcaacggcgaacgcctgttggcggaattt
ccagaatgcggcaaagcattgtccaaataccgcatcaatcccggcaatgtcggcaaaggc
gtaaaaggcgatgaaaaatttgcctttatgattcggactgctgctgaaaacgataaagcc
gtccgcatcggcgtaaactggggttctttggatcaaagcctcgccaaacgtatgatggat
gccaacctcgcttcttccgcgccgaaaccgcccgaagaagtgacgaaggaagcactgatt
gtctccgctttggaatctgccgaaaaagccgttctattgggactgcccgaagacaaaatc
atcctgtcgtgcaaagtcagcgcggttcaggatttgattcaggtttaccgcgaactgggc
agccgttgcgcctatccgctgcatttgggtttgaccgaagccggtatgggcagcaaaggc
attgtcgcatcaacggcggcattatccgtcttgcttcaagaaggaatcggcgacaccatc
cgcatttcactgactccggaacctggcagcccgcgtactcaggaggtcgtcgtcgggcaa
gagattttacagactatgggattgcgttcgtttacgccgatggttaccgcctgccccggc
tgcgggcgtaccaccagtaccgtatttcaagagctggcacaagatgttcaaaattacctg
cgccaaaaaatgtctatatggcgtaccctttatcctggggttgaatccctgaacgttgcc
gtaatgggctgcgttgtcaatgggcccggagaaagcaaattggccgacatcggcatcagc
ctgcccggtacgggagaaacacccgttgcccctgtttatgtagatggtgaacgtaaagta
acgctgaaaggcgacaacattgcaacggaatttctggctattgttgaagagtatgtcaaa
accaattatggggagaacggactcaaacgccatcaagggaaggttatcccgatacactcc
ctataa

DBGET integrated database retrieval system