KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1315Help
Entry
NMB1315           CDS       T00027                                 

Gene name
uraA
Definition
(RefSeq) uracil permease
  KO
K02824  
uracil permease
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Transporters [BR:nme02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   NMB1315 (uraA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1334052..1335263
Genome map
AA seq 403 aa AA seqDB search
MNQLKLAVSGAQILFVAFGAMVLVPLLTGLNPALALLGAGLGTLLFQITTKRKVPIFLGS
SFAFIAPIIYSVGEWGLPSTMFGLFAAGFMYFVFAALIRWRGLAAVHKLLPPVVIGPVIM
VIGLSVAVAASSMAMGQADGKQVIDYTDSLILSGFTFAVTAIVSVFGSRMMKLIPILIGV
ASGYVLALLMGLVDTASIAHAPWFAVPHFETPQINWQAALFMLPVAVAPAIEHIGGIMAI
GNVTGKDYTKDPGLDKTLAGDGLGVCVAGLIGGPPVTTYGEVTGAVMITKNSNPVIMTWA
AVFAVCMAFFGKFNAFLASIPMPVMGGIMLLLFGTIASLGVKTLIDAKVDLMLPKNLVIV
SSVLTTGIGGMTLKLGSFSFAGVGLCAVLAIMLNSLLPDPKES
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaactgaaacttgccgtttccggtgcacagattttatttgtggcattcggcgca
atggtgctggttcccctgctgaccggtctgaatccggctcttgcgcttttgggcgcaggc
ttgggaacgctgctgttccaaatcacaaccaaacgcaaagtgccgatttttcttggttct
tcgtttgcctttatcgcaccgattatctactccgtcggcgaatgggggctgccttccacc
atgttcggactgtttgccgccggctttatgtattttgtgtttgccgcgctgatccgttgg
cgcggactggcagcggtacacaaactgctgcctccggtcgtcatcggccccgtcatcatg
gtcatcggtctgtctgttgccgtggcggcaagcagcatggcaatgggtcaggcggacggc
aaacaggtcatcgactataccgattcgctgattctttccggctttacctttgccgttacc
gccatcgtatcggttttcggcagcaggatgatgaagctgattcccatcttgatcggtgtc
gcttcgggttatgttttggcactgctgatgggactggtggacacggcaagcattgcacac
gcgccctggttcgccgttccccattttgaaacgcctcagatcaactggcaggctgcactg
tttatgctgcccgttgccgtcgcccccgccatcgaacacatcggcggcatcatggcaatc
ggcaatgtgacggggaaagactatacgaaagacccgggcttggacaaaacccttgcaggc
gacggtttgggcgtatgcgttgcgggtctgatcggcggcccgccggttacgacctacggc
gaagtaacgggtgcggtgatgattaccaaaaacagcaaccccgtcatcatgacttgggcg
gcggtttttgccgtctgcatggcgtttttcggcaaattcaatgcgtttttggcttccatt
ccgatgccagtaatgggcggcattatgctgctgctgttcggcacgattgcttctttgggc
gtgaaaacgctgattgatgccaaagtcgatttgatgctgccgaaaaacctggtcatcgtc
agctcggtactgaccacgggcatcggcggcatgacgctcaaattgggcagcttcagcttt
gccggcgtgggcttgtgcgccgtacttgccattatgttgaacagcctgctgcccgatccg
aaagaatcctga

DBGET integrated database retrieval system