KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1318Help
Entry
NMB1318           CDS       T00027                                 

Gene name
pssA
Definition
(RefSeq) CDP-diacylglycerol--serine O-phosphatidyltransferase
  KO
K17103  
CDP-diacylglycerol---serine O-phosphatidyltransferase [EC:2.7.8.8]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Glycerophospholipid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NMB1318 (pssA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB1318 (pssA)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.8  CDP-diacylglycerol---serine O-phosphatidyltransferase
     NMB1318 (pssA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1336381..1337127
Genome map
AA seq 248 aa AA seqDB search
METPTNTPQRSLRQNSIYLLPNSFTIAALFSAFYAITQSMHGRYETAAIAVFISMLLDGM
DGRVARLTNSQSAFGEQLDSLADMVSFGVAPALIAYKWQLWQFGKIGYSVAFIYCACAAL
RLALFNTLIGKVDKRWFIGVPSPTAAALIVGLIWVNHSVEKFPAVHWWALGITLFAGLSM
IVQIPFWSFKEINIRRQVPFVGMLLAVLLLLLVTWEPSLVLFLFFLGYSLSGYIMAARRF
WKKYRKAD
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccccgaccaacaccccgcaacgctccctgcgtcaaaacagtatctacctgctg
cccaattcctttactatcgccgcgctgttttccgcgttttacgcaatcacccaatccatg
cacggacgttatgaaaccgccgccatcgcggtattcatctctatgttgctggacggtatg
gacgggcgcgtggcgcggctgaccaacagccaaagcgcgttcggggagcagctcgacagc
cttgccgatatggtcagcttcggcgttgctcccgctctgattgcctacaaatggcagctt
tggcagttcggcaaaatcggttattccgtcgccttcatctactgcgcctgcgccgccctg
cgcctcgccctgttcaacacactcatcggcaaggtggacaaacgctggtttatcggcgtg
cccagtccgactgccgccgcgctgattgtcgggctgatttgggtcaaccacagcgtcgaa
aaattccccgccgtccactggtgggcattgggcatcacactgtttgccggcctgtcgatg
attgtccaaatccctttttggagttttaaagaaatcaacatccgcagacaagtccccttt
gtcggaatgctgcttgccgtcttactgctgcttctggtcacttgggaaccgtcgctcgtc
ctcttcctgttctttctcggatacagcctgtccggctacattatggcggcacgccgattt
tggaaaaagtacagaaaggcggattaa

DBGET integrated database retrieval system