KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1324Help
Entry
NMB1324           CDS       T00027                                 

Gene name
trxB
Definition
(RefSeq) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    NMB1324 (trxB)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     NMB1324 (trxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox DAO FAD_binding_2 Thi4 GIDA FAD_oxidored HI0933_like K_oxygenase NAD_binding_7 Hema_HEFG Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 903746
NCBI-ProteinID: NP_274343
UniProt: Q9JZ28
Position
complement(1339659..1340609)
Genome map
AA seq 316 aa AA seqDB search
MSQHRKLIILGSGPAGYTAAVYAARANLNPVIITGIAQGGQLMTTTEVDNWPADADGVQG
PELMARFLAHAERFGTEIIFDQINAVDLQKRPFTLKGDMGEYTCDALIVATGASAKYLGL
PSEEAFAGKGVSACATCDGFFYKNQDVAVVGGGNTAVEEALYLANIAKTVTLIHRRSEFR
AEKIMIDKLMKRVEEGKIILKLESNLQEVLGDDRGVNGALLKNNDGSEQQIAVSGIFIAI
GHKPNTDIFKGQLEMDEAGYLKTKGGTADNVGATNIEGVWAAGDVKDHTYRQAITSAASG
CQAALDAERWLGSQNI
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaacaccgcaaactgattattttgggttccggccccgccggatacaccgccgcc
gtctatgccgcgcgcgccaatttaaaccccgtcattattacaggtatcgcgcaaggcggg
caactgatgaccaccaccgaagtggacaactggcctgccgatgccgacggcgtgcaaggg
ccggaattgatggcgcggtttctcgcccacgccgaacgtttcggaacggaaatcattttt
gaccaaatcaacgccgtcgatctgcaaaaacgcccgtttacactcaaaggcgatatgggc
gagtacacttgcgatgccctgattgtcgcaacaggcgcgtccgccaaatacctcggtttg
ccgagtgaggaagcgtttgcaggaaaaggcgtttccgcttgtgccacctgcgacggtttc
ttctataaaaaccaagatgttgccgtagttggcggcggcaatacggcagttgaagaggca
ctctaccttgccaatatcgccaaaaccgttaccctgatccaccgccgcagcgagttccgt
gccgaaaaaatcatgatcgacaaactgatgaaacgcgtggaagagggcaaaatcatcctc
aagctggaaagcaacctgcaagaagtactgggcgacgatcggggcgtaaacggcgcatta
ttaaaaaacaacgacggttctgagcaacaaattgccgtcagcggcatttttatcgccatc
gggcacaagccgaataccgatattttcaaaggtcagttggaaatggacgaagccggttac
ctgaaaaccaaaggcggcacggcggacaatgtcggcgcaaccaatatcgaaggcgtatgg
gcggcgggcgacgtaaaagaccatacctaccgtcaggcgattaccagcgcggcttccggc
tgtcaggcggctttggacgcggaacgctggctgggcagccaaaacatttga

DBGET integrated database retrieval system