KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1353Help
Entry
NMB1353           CDS       T00027                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K08324  
succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Alanine, aspartate and glutamate metabolism
Butanoate metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    NMB1353
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB1353
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NMB1353
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     NMB1353
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     NMB1353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1375792..1377135)
Genome map
AA seq 447 aa AA seqDB search
MFHSVNVFTGETLYRRPAQDYAEFERRLADLKMRGGAFAQLGVTERAARLQKFADRLEAE
KERFAEMVCEEVGRCLHECRAEIGKSIELIRYYARLAPELLAHKTIATQASLSQVRFEPL
GVVFAVMPWNYPVWQVLRFAVPAMCAGNACAVKPAPSVARVSQALFDLASDGIPLAGVWL
DEAGTLKAVEDTDAMAFTGSTHTGRILAAHAGANLKKTVLELGGSNAFIVMPDADLERAA
AEACYSRFRDAGQSCNAAKRIIVTEAAADRFITLFLAECAKLKMGDPKHPDTTLAPLHRE
DLRDRVHGQVEDAVSNGAVCLTGGKIPQGRGWFYPATVLDRVNPACRVWREEVFGPAALI
LRAENEEHAIALANDSPFGLGACIYTADTERAWRFAEKIQAGSVFINRHTSSDLRLPFGG
VKDSGYGRELSEFGLYEFVNVKTYWQK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtttcacagtgtcaatgtatttacgggcgaaacgctttaccgccgccccgctcaagat
tatgcggagtttgaacggcggctggcggatttgaaaatgcgcggcggggcgttcgcgcaa
ctgggcgtaaccgaacgtgccgcgcgcctgcaaaaatttgccgaccgtttggaggcggag
aaagagcgttttgcggaaatggtgtgtgaggaagtcggacgctgcttgcacgaatgccgt
gcggaaatcggcaagtctatcgaactgatacgctattacgcccgccttgcccccgaactg
cttgcccacaaaaccatcgcgacgcaggcgagtttgagtcaggtgcgcttcgagcctttg
ggcgtggtgtttgccgtcatgccttggaactatcccgtctggcaggtattgcgtttcgcc
gttcccgctatgtgcgcgggcaacgcgtgcgccgtcaaacccgcgcccagcgtggcacgc
gtcagtcaggcactgttcgatttggcttcagacggcattcctctggcaggcgtgtggctg
gatgaggcgggcacgctcaaggcggttgaagataccgatgcaatggcgtttaccggttca
acgcatacggggcgcatccttgcggcacacgcgggcgcaaaccttaagaaaaccgtgttg
gagctcggcggtagcaacgcctttatcgtgatgcccgatgctgatttggagcgtgccgcc
gcagaagcctgttattcccgtttccgcgatgcggggcaatcgtgtaacgccgccaagcgc
atcatcgtaaccgaagccgcagccgatcgttttatcacgctgtttcttgccgaatgcgct
aaattgaaaatgggcgaccccaaacatcccgatactacgcttgcaccgctgcaccgcgaa
gatttgcgggacagggttcacgggcaggttgaagatgccgtttcaaacggcgcggtatgc
ctgaccggcggaaaaatcccacaagggcgaggctggttttatcccgcgacggttttagac
agggtaaatcctgcctgccgcgtctggagagaagaagtattcgggccggccgccctgatt
ttgcgcgccgaaaacgaagaacatgccatcgcccttgccaatgattccccgttcgggctc
ggtgcctgcatttataccgccgataccgaacgcgcttggcggtttgccgaaaaaatacag
gcgggatcggtgtttatcaaccgccataccagcagcgatttgcgcctgcctttcggcgga
gtcaaagattccggttacgggcgcgaattgtccgaattcgggctgtacgagttcgtcaac
gtcaaaacctactggcagaaatga

DBGET integrated database retrieval system