KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1360Help
Entry
NMB1360           CDS       T00027                                 

Gene name
pdxH
Definition
(RefSeq) pyridoxamine 5'-phosphate oxidase
  KO
K00275  
pyridoxamine 5'-phosphate oxidase [EC:1.4.3.5]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NMB1360 (pdxH)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.5  pyridoxal 5'-phosphate synthase
     NMB1360 (pdxH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1383496..1384128)
Genome map
AA seq 210 aa AA seqDB search
MDLHNIREDYSKRELSEADCADNPIEQFERWLDEAVRAQVNEPTAVNVAAVDGRGRPNSR
MVLLKEVNSEGFVFFTNYHSRKGRSLDAHPFAAMTFFWPELERQVRVEGRVERLAEKLSD
EYFESRPYQSRLGAWASAQSEVIPNKAVLVAKAAAVGLKHPLHVPRPPHWGGYIVIPDLL
EFWQGRPSRLHDRIQYRLLDGGWIRERLSP
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggatttgcacaatattcgggaagattacagcaaacgggaattgtcggaagccgattgc
gccgataatccgatcgagcagttcgagcggtggttggacgaggcggtacgcgcacaggtc
aacgagccgacggcggtcaatgtggcggcggttgacggacgcggcaggcccaacagccgt
atggtgctgctgaaggaagttaattctgaaggttttgttttctttacgaattatcacagc
cgcaaggggcgttcgctggatgctcatccatttgcggcgatgacgtttttttggccggag
ctggagcgtcaggtgcgcgtggaagggcgtgttgaaaggctggcggagaagttgtcggac
gaatattttgagagtcgcccgtatcagagccgtttgggtgcgtgggcaagtgcgcagagc
gaggttattccgaacaaggcggtattggtggcaaaggcggcggcggttggactcaaacat
cctctgcatgtgccgcgtccgccgcattggggcggctatattgtgattcccgatttgctt
gagttctggcagggcagaccgagcaggctgcacgaccgcatccaataccgtttgctggat
ggtggctggatacgcgagcggctgtcgccttga

DBGET integrated database retrieval system