KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1360Help
Entry
NMB1360           CDS       T00027                                 

Gene name
pdxH
Definition
(RefSeq) pyridoxamine 5'-phosphate oxidase
  KO
K00275  pyridoxamine 5'-phosphate oxidase [EC:1.4.3.5]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00750  Vitamin B6 metabolism
nme01100  Metabolic pathways
nme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NMB1360 (pdxH)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.5  pyridoxal 5'-phosphate synthase
     NMB1360 (pdxH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Putative_PNPOx PNP_phzG_C Pyridox_oxase_2
Motif
Other DBs
NCBI-GeneID: 903782
NCBI-ProteinID: NP_274378
UniProt: Q9JYZ5
Position
complement(1383496..1384128)
Genome map
AA seq 210 aa AA seqDB search
MDLHNIREDYSKRELSEADCADNPIEQFERWLDEAVRAQVNEPTAVNVAAVDGRGRPNSR
MVLLKEVNSEGFVFFTNYHSRKGRSLDAHPFAAMTFFWPELERQVRVEGRVERLAEKLSD
EYFESRPYQSRLGAWASAQSEVIPNKAVLVAKAAAVGLKHPLHVPRPPHWGGYIVIPDLL
EFWQGRPSRLHDRIQYRLLDGGWIRERLSP
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggatttgcacaatattcgggaagattacagcaaacgggaattgtcggaagccgattgc
gccgataatccgatcgagcagttcgagcggtggttggacgaggcggtacgcgcacaggtc
aacgagccgacggcggtcaatgtggcggcggttgacggacgcggcaggcccaacagccgt
atggtgctgctgaaggaagttaattctgaaggttttgttttctttacgaattatcacagc
cgcaaggggcgttcgctggatgctcatccatttgcggcgatgacgtttttttggccggag
ctggagcgtcaggtgcgcgtggaagggcgtgttgaaaggctggcggagaagttgtcggac
gaatattttgagagtcgcccgtatcagagccgtttgggtgcgtgggcaagtgcgcagagc
gaggttattccgaacaaggcggtattggtggcaaaggcggcggcggttggactcaaacat
cctctgcatgtgccgcgtccgccgcattggggcggctatattgtgattcccgatttgctt
gagttctggcagggcagaccgagcaggctgcacgaccgcatccaataccgtttgctggat
ggtggctggatacgcgagcggctgtcgccttga

DBGET integrated database retrieval system