KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1377Help
Entry
NMB1377           CDS       T00027                                 

Gene name
lldD
Definition
(RefSeq) L-lactate dehydrogenase
  KO
K00101  
L-lactate dehydrogenase (cytochrome) [EC:1.1.2.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pyruvate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMB1377 (lldD)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.2  With a cytochrome as acceptor
    1.1.2.3  L-lactate dehydrogenase (cytochrome)
     NMB1377 (lldD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1404902..1406074)
Genome map
AA seq 390 aa AA seqDB search
MKRDLSKMTCIEDLRRVAKRKMPRMFYDYIDSGSWTETTYRENTSDFKDIRFRQKVLVNM
EGRSLETKMIGQDVKMPVAIAPTGFTGMAHADGEILAARAAEKFGIPFTLSTMSICSIED
VAENTSAPFWFQLYVMRDREFMENLIKRAKDAKCSALVLTADLQVLGQRHKDIKNGLSAP
PKPTIANLINLATKPEWCMKMLNTERRTFRNIVGHAKNVGDLSSLSSWTSEQFDPRLSWD
DVARIKDLWGGKLIIKGIMEPEDAEKAAKSGADALIVSNHGGRQLDDTVSAIKALPDIVS
AVGSDIEVWMDSGIRSGQDILKAWALGAKGTMIGRAFLYGLGAYGEEGVTRALEILYKEM
DISMAFTGHRDIQDVDASILRGKDWGRETV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgatttgagcaaaatgacctgcatcgaagacttgcgccgcgttgccaagcgc
aaaatgccgcgtatgttttacgattacatcgattcgggttcgtggacagaaactacctac
cgtgaaaacacttcggatttcaaagacatccgcttccgtcaaaaagtattggtcaatatg
gaaggccgaagcctggaaaccaaaatgatcgggcaggatgtgaaaatgccggtggcgatt
gcgccgacgggtttcacgggtatggcacacgccgacggtgaaattttggcggcgcgggcg
gcggagaagttcggcattccgtttacgctgtccacgatgtctatctgctcgattgaagac
gttgccgagaacacttccgcaccattttggtttcagctttatgtgatgcgcgaccgcgag
tttatggaaaacctgattaagcgcgcgaaggatgccaaatgttcggcattggtattgacc
gctgatttgcaggttttggggcaacgccacaaagacatcaaaaacggcctgtccgcgccg
ccgaaaccgaccatcgccaatttaatcaatctggcgaccaagcccgaatggtgtatgaaa
atgctgaacacggaacgccgcacgttccgcaatatcgtcggacacgcgaagaacgtcggc
gatttgtcttcgctgtcttcatggacttccgaacaattcgacccgcgcctgagctgggac
gatgtggcgcgcattaaagatttgtggggcggcaagctgattatcaaaggcattatggaa
cctgaagacgcggaaaaagcagcgaaaagcggcgcggacgcattgattgtttccaaccac
ggcggtcgacagctcgacgataccgtgtctgccatcaaagccttgcccgacatcgtcagc
gcagtgggcagcgacatcgaagtttggatggacagcggcatccgcagcggtcaggatatt
ttgaaggcgtgggctttgggcgcgaaaggtacaatgataggtcgggcgttcctgtatggc
ttgggcgcgtatggagaagaaggcgtaacccgtgcgctggaaatcctgtataaagaaatg
gatatatctatggcgtttacgggacaccgcgatattcaagatgtcgatgcttcgattttg
agaggcaaagattggggcagggaaacggtttag

DBGET integrated database retrieval system