KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1388Help
Entry
NMB1388           CDS       T00027                                 

Gene name
pgi
Definition
(RefSeq) glucose-6-phosphate isomerase
  KO
K01810  
glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB1388 (pgi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB1388 (pgi)
   00030 Pentose phosphate pathway
    NMB1388 (pgi)
   00500 Starch and sucrose metabolism
    NMB1388 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    NMB1388 (pgi)
Enzymes [BR:nme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     NMB1388 (pgi)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NMB1388 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   NMB1388 (pgi)
  Exosomal proteins of colorectal cancer cells
   NMB1388 (pgi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1414892..1416538)
Genome map
AA seq 548 aa AA seqDB search
MKHLHDLPAWSKLWNHFDDSKTLHMREMFEQDPQRAERYWLQVGGLTLDYSKNRINDETM
SLLFELAREAGVPERMRQMFHGEKINTTENRAVLHVALRNRTNSPIVVDGEDVMPKVNRV
LQRMGEFAHEVRSGSWLGYTNQVITDVVNIGIGGSDLGPLMMCTALKPFGHPRLNMHFVS
NVDGSQLRDVLSKVHPETTLFIIASKTFTTQETLTNALTAREWFLNHAGDEEAVAKHFAA
VSTNQKAVAEFGIDTANMFEFWDWVGGRYSLWSAIGLPIMLYLGEENFIEMLNGAHLMDQ
HFINTPLERNLPVILALIGIWYINYYGGGSHVIAPYDQHLHRLPKFIQQLDMESNGKQVT
LDGKAVGHETSPIIWGETGINGQHAFFQLLHQGTHITPIDLIASLEKRSNLPGHHEILLA
NVFAQAEAFMRGKTPDEVRAELKAQGMDEVRIEELVPHKTFSGNRPTNLILMDKVNPRNM
GSLIAMYEHKTFVQGIIWGINSFDQWGVELGKQLAKTILGELTGETGPQKHDSSTERLIN
LYLQTNRK
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaccttcacgacttacccgcatggtcgaaattgtggaatcactttgacgacagc
aaaacattgcatatgcgcgaaatgttcgagcaagacccgcagcgtgcggaacgctactgg
ctgcaagtcggcggactgacgctggactactccaaaaaccgcatcaacgacgaaaccatg
tcgcttttgttcgagcttgcccgagaagcaggcgtgccggagcggatgcggcagatgttc
cacggcgaaaaaatcaataccaccgaaaaccgcgccgtcctgcatgtcgcccttcgcaac
cgcaccaattcgccgattgtggttgacggtgaagatgtgatgcccaaagtcaaccgcgtt
ttgcaacgtatgggcgaatttgcacacgaagtccgcagcggaagctggctgggctatacc
aaccaagtcattaccgacgttgtcaacatcggcatcggcggatcggatttgggtccgctg
atgatgtgtaccgcgctcaaacctttcggtcatccgcgcctcaatatgcacttcgtctcc
aacgtggacggctcgcaactgcgcgacgtattgtccaaagtccaccccgaaaccacgttg
ttcatcatcgcctccaaaacatttaccacgcaggaaacgctgaccaacgcgctgaccgcg
cgcgaatggtttttgaatcatgcgggcgacgaagaagccgttgccaaacacttcgccgcc
gtttccaccaatcaaaaagccgtcgccgaattcggcatcgacaccgccaatatgtttgaa
ttttgggattgggtcggcggtcggtacagcctgtggtccgccatcggattgccgattatg
ctgtatctcggcgaagaaaacttcattgaaatgctcaacggcgcgcacctgatggaccaa
cacttcatcaacacaccgctcgagcgcaacctgcccgtcattctcgccctcatcggcatc
tggtatatcaactactacggcggcggcagccacgtcatcgcgccttacgaccaacatttg
caccgcctgcccaaattcatccagcagctcgatatggaaagtaacggcaaacaggttacg
ttggacggcaaagcagtcggacacgaaacctcgccgattatctggggcgaaacgggcatt
aacggccagcacgcctttttccaactgctgcaccaaggcacgcacattacccccatcgac
ctgattgcctcgcttgaaaaacgcagcaacctgcccggacaccacgaaatcctgcttgcc
aacgtcttcgcccaagcagaagcctttatgcgcggcaaaacccccgacgaagtccgcgcc
gaactcaaagcgcagggtatggatgaggtgcgcatcgaagagctggtcccgcacaaaacc
ttctccggcaaccgcccgaccaacctcattctcatggacaaggtcaacccgcgcaatatg
ggcagcctgattgccatgtacgaacacaaaaccttcgtacaaggcatcatttggggcatc
aacagcttcgaccagtggggcgtggaactcggcaaacaactggctaaaaccattttgggc
gaactgaccggcgaaaccgggccgcaaaagcacgacagttcgaccgaacgcctgatcaac
ctctacctgcagaccaaccgcaaataa

DBGET integrated database retrieval system