KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1391Help
Entry
NMB1391           CDS       T00027                                 

Definition
(RefSeq) Sol/DevB family oxidoreductase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00030  Pentose phosphate pathway
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
Module
nme_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
nme_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
nme_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB1391
Enzymes [BR:nme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     NMB1391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso Sugar-bind
Motif
Other DBs
NCBI-GeneID: 903813
NCBI-ProteinID: NP_274405
UniProt: P63337
Position
complement(1418524..1419219)
Genome map
AA seq 231 aa AA seqDB search
MFVWHEYENAAEAAQSLADAVADALQGALDEKGGAVLAVSGGRSPIAFFNALSQKDLDWK
NVGITLADERIVPTVHADSNTGLVREYLLKNKAEAAMWIPMVEDGKTETELHPDAVVDYA
LKHYKQPDVLVLGMGNDGHTASIFPKAPQFQTAIDGSAGVALVHTTPVTAPHERVSMTLD
AIAHTGHVFLAIRGEEKKAVFDQAAQGENREYPINLVLNHQGVNCHVFYAE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtttggcacgaatacgaaaatgcggcagaagcggcgcagtctttggctgacgca
gtggcggatgctttgcagggcgcactggacgagaagggcggtgcggtgttggcagtttcc
ggcggacgttcgccgattgcatttttcaacgccctgtcgcaaaaagatttggattggaaa
aacgtcggcatcaccttggcagatgaacgcatcgtgccgaccgtccacgccgacagcaat
accggtttggtgcgcgaatacctgttgaagaacaaagcggaagcggcaatgtggattcct
atggtggaagacggaaaaactgaaaccgaattacatcccgatgctgttgtcgattatgca
ctgaaacattacaaacagcccgatgttttggttttgggtatgggaaacgacgggcatacg
gcttcgattttcccgaaagctccgcagtttcagacggcaatcgacggttcggcaggtgtc
gcgttggtgcataccacgcccgttaccgcgccgcacgagcgcgtcagtatgaccttggat
gcgattgcccatacggggcatgtgtttttggcgatacggggcgaagagaaaaaagccgtg
ttcgaccaagccgcacaaggcgaaaaccgcgaatatccgatcaacctcgttttgaaccat
caaggagtgaactgccatgtcttctacgccgaataa

DBGET integrated database retrieval system