KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1392Help
Entry
NMB1392           CDS       T00027                                 

Gene name
zwf
Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  
glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pentose phosphate pathway
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB1392 (zwf)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB1392 (zwf)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NMB1392 (zwf)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     NMB1392 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     NMB1392 (zwf)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NMB1392 (zwf)
  Exosomal proteins of colorectal cancer cells
   NMB1392 (zwf)
  Exosomal proteins of bladder cancer cells
   NMB1392 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1419499..1420944)
Genome map
AA seq 481 aa AA seqDB search
MSTQTNFDLVLFGATGDLAMRKLLPCLYQAHVAGLLHPEGRILGVSRSELDTEGFLAKVE
TSSKIHVKENFSDEAWASFVERFAYLKVDVTQPDDFAALGDLVKARKETDNVVIYLSTAP
KFFAQACENLAAIGLNADNVRVVLEKPLGTDLASSQQINTDVARYFKEGQIYRIDHYLGK
ESLQNLLALRFANVMFEPLWNNKYIESVQLTIAEQLGVEERGEFYDITGALRDMVQNHLM
QMLCMTAMEAPASLDADAVRDEKVKVIKSLKPLTVESVNENVVRGQYTAARGMNGYLEEI
NVPQDSFTETYVAIKAEIENERWKGVPFYLRTGKRMAGKVAEIVLNFKDLNSHIFEGSRT
APNRLVIELQPYESVRLYTQMKTPGAGNKVETVPLATDLGKALEGRRAEAYERLLLDVIN
GKLALFNRRDELEAAWEYVMPILENWTNNTTPPHGYGAHSWGPEAARELLARDGHKWHEE
Q
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacaaacaaattttgatttggtgttgttcggtgcgaccggcgatttggcgatg
cgcaagctgttgccctgtctgtaccaggcgcatgttgccggtctgcttcatcccgaaggg
cgtattttgggggtcagccgcagcgagttggataccgaaggttttctggcgaaggtggaa
accagttccaaaatccatgtgaaagaaaatttttccgatgaggcttgggcatcgtttgtc
gaacgtttcgcatatctcaaagtcgatgttacgcagccggacgattttgccgctttgggc
gatttggtcaaagcgcgcaaagaaaccgacaacgtcgtcatctatctgtccaccgcgccc
aaattcttcgcgcaagcctgtgaaaaccttgctgcgatcggtttgaatgccgacaatgtg
cgcgtagttttggaaaaaccgttgggtacggatttggcttcttcccagcaaatcaatacc
gatgttgcgcgttatttcaaagaagggcaaatttaccgcatcgaccactaccttggcaaa
gaaagcctgcaaaacctgcttgcgctgcgttttgccaatgtaatgttcgagccgctgtgg
aacaataaatatatcgaaagcgtgcagttgaccatcgccgaacagctcggtgtggaagag
cgcggtgagttttacgacattaccggcgcgttgcgcgatatggtgcaaaaccatttgatg
cagatgttgtgcatgactgcgatggaagcccccgccagcttggatgccgacgcggtgcgc
gatgaaaaagtcaaagtcatcaagtcattgaagccgctgaccgtcgagtctgtcaatgaa
aacgtcgtgcgcggacaatataccgccgccagaggcatgaacggctatcttgaagaaatc
aacgttccgcaagacagctttaccgaaacctacgtcgccattaaagccgaaatcgaaaac
gaacgctggaagggcgttcccttctacctgcgtaccggcaaacgcatggcgggcaaagtg
gcggaaatcgttttgaacttcaaagatttgaacagccatatttttgaaggcagccgcacc
gcgcccaaccggctcgttatcgagttgcaaccatatgaatccgtgcgcctctatacgcag
atgaaaaccccgggggcaggaaataaggtcgaaaccgtgccgctggcaaccgatttgggc
aaagcattggaaggccgccgcgcggaagcttacgagcgcctgctgctggatgtgattaac
ggcaaactcgctttgtttaaccgccgcgacgaacttgaagccgcgtgggaatatgtgatg
ccgattttggaaaactggacaaataacaccacgccgccgcacggctacggcgcacactcg
tgggggcctgaagccgcgcgcgaactattggcgcgcgacggacacaagtggcacgaagag
cagtaa

DBGET integrated database retrieval system