KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1394Help
Entry
NMB1394           CDS       T00027                                 

Gene name
eda
Definition
(RefSeq) keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
  KO
K01625  
2-dehydro-3-deoxyphosphogluconate aldolase / (4S)-4-hydroxy-2-oxoglutarate aldolase [EC:4.1.2.14 4.1.3.42]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pentose phosphate pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB1394 (eda)
   00630 Glyoxylate and dicarboxylate metabolism
    NMB1394 (eda)
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.14  2-dehydro-3-deoxy-phosphogluconate aldolase
     NMB1394 (eda)
   4.1.3  Oxo-acid-lyases
    4.1.3.42  (4S)-4-hydroxy-2-oxoglutarate aldolase
     NMB1394 (eda)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1423528..1424166
Genome map
AA seq 212 aa AA seqDB search
MSKLTPREILTAGAVVPVMAIDDLSTAIDLSHALVEGGIPTLEITLRTPVGLDAIRLIAK
EVPNAIVGAGTVTNPEQLKAVEDAGAVFAISPGLHESLAKAGHNSGIPLIPGVATPGEIQ
LALEHGIDTLKLFPAEVVGGKAMLKALYGPYADVRFCPTGGISLATAPEYLALPNVLCVG
GSWLTPKEAVKNKDWDTITRLAKEAAALKPKA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaactgaccccccgcgaaattttgaccgccggcgcagttgtgccggtaatggcg
attgacgacttaagcaccgccatcgatttgtcccacgcccttgtcgaaggcggcatccct
accctcgaaatcaccctgcgcacccctgtcggcctcgatgccatccgcctgattgccaaa
gaagtgcccaacgccatcgtcggcgcaggtacggtaaccaatcccgaacagctcaaagcc
gtcgaagacgcaggcgcggttttcgccatcagcccggggctgcatgaatccctcgccaaa
gccggccacaacagcggcatccccctgattcccggtgttgccaccccgggcgaaatccaa
ctggctttggaacacggcatcgacaccctcaaactcttccccgccgaagtcgtcggcggc
aaagccatgctcaaagccctgtacggcccttacgccgatgttcgcttctgcccgacaggc
ggcatcagcctcgccaccgcgcccgagtacttggcactgcccaacgtcctgtgcgtcggc
ggctcttggctgacaccgaaagaagccgtgaaaaacaaagactgggacaccatcacccgc
ctcgccaaagaagcggcggcgttgaaacccaaagcctga

DBGET integrated database retrieval system