KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1395Help
Entry
NMB1395           CDS       T00027                                 

Definition
alcohol dehydrogenase
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NMB1395
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     NMB1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1424425..1425465)
Genome map
AA seq 346 aa AA seqDB search
MKAMVYHGANDIRFEEKPRPQIIDPTDAVVKIVKTTICGTDLGIWKGKNPEVADGRILGH
EGIGIVEEVGEAVKNIKVGDKVIISCVSKCCTCDNCKTQLYSHCRNGGWILGYMIDGTQA
EYVRTPYADNSLVPLPDNVNEEIALLLSDALPTAHEIGVQYGDVKPGDTVFIAGAGPVGM
SALLTAQLYSPAAIIVCDMDENRLKLAKELGATHTINPASGEVSKQVFAIVGEDGVDCAI
EAVGIPATWNMCQDIVKPGGHIAVVGVHGQSVDFKLEKLWIKKLAITTGLVNANTTEMLM
KAISSSSVDYTKMLTHHFKFSELEKAYDVFKHAAENQVMKVVLEAD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatggtttatcacggcgcaaacgacatccgttttgaagaaaaaccccgtccg
cagattatcgatccgaccgatgcggtggtgaaaatcgtcaaaaccacgatttgcggtacc
gatttgggtatttggaaaggcaaaaaccccgaagttgccgacggccgtattctcggtcat
gagggcatcggtattgtagaagaagtcggcgaggctgtaaaaaacatcaaagtcggcgat
aaagtcattatttcatgcgtcagcaaatgttgcacttgcgacaactgcaaaacccaactc
tattcacactgccgtaacggcggttggattttgggttacatgattgacggtactcaggcc
gaatacgtccgtacgccttatgccgacaacagcctcgttccgctgcccgataatgtcaac
gaagaaatcgccctgttgttgagcgacgctttgccgaccgcccacgaaatcggcgtgcaa
tacggcgatgtcaaacccggcgacaccgtattcatcgctggggcaggccctgtcggtatg
tccgccctgttgaccgcccaactgtacagtcccgccgccatcatcgtttgcgatatggac
gaaaaccgtttgaaactggcgaaagaattgggtgcgacccataccattaaccctgcttcc
ggcgaagtatccaaacaagtctttgccatcgtcggcgaagacggcgtggattgcgccatc
gaagccgtcggtatccctgctacatggaatatgtgccaagacattgtgaaacccggcggc
catatcgctgtggttggtgtacatggtcaatccgttgatttcaaactggaaaaactctgg
attaaaaagcttgccatcactaccggtctggtaaacgccaataccaccgaaatgctgatg
aaggcgatttccagcagctccgtcgattacaccaaaatgctgacccatcatttcaaattc
agtgaattggaaaaagcctacgacgtgttcaaacacgccgccgaaaaccaagtgatgaaa
gtggttttggaagcggattaa

DBGET integrated database retrieval system