KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1398Help
Entry
NMB1398           CDS       T00027                                 

Gene name
sodC
Definition
(RefSeq) superoxide dismutase
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NMB1398 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1427085..1427645
Genome map
AA seq 186 aa AA seqDB search
MNMKTLLALAVSAVCSVGVAQAHEHNTIPKGASIEVKVQQLDPVNGNKDVGTVTITESNY
GLVFTPDLQGLSEGLHGFHIHENPSCEPKEKEGKLTAGLGAGGHWDPKGAKQHGYPWQDD
AHLGDLPALTVLHDGTATNPVLAPRLKHLDDVRGHSIMIHTGGDNHSDHPAPLGGGGPRM
ACGVIK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgaaaaccttattagcactagcggttagtgcagtatgttcagttggtgttgcg
caagcacacgagcataatacgatacctaaaggtgcttctattgaagtgaaagtgcaacaa
cttgatccagtaaacggtaacaaagatgtgggtacagtgactattactgaatctaactat
ggtcttgtgtttacccctgatttacaaggattaagcgaaggcttacatggtttccacatc
catgaaaacccaagctgtgagccaaaagaaaaagaaggtaaattgacagctggtttaggc
gcaggcggtcactgggatcctaaaggtgcaaaacaacatggttacccatggcaagatgat
gcacacttaggtgatttacctgcattaactgtattgcatgatggcacagcaacaaatcct
gttttagcaccacgtcttaaacatttagatgatgttcgcggtcactctattatgatccac
acgggtggtgataatcactccgatcatccagctccacttggcggtggcggcccacgtatg
gcatgtggcgtgattaaataa

DBGET integrated database retrieval system