KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1416Help
Entry
NMB1416           CDS       T00027                                 

Gene name
pepN
Definition
(RefSeq) aminopeptidase
  KO
K01256  
aminopeptidase N [EC:3.4.11.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glutathione metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NMB1416 (pepN)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     NMB1416 (pepN)
Peptidases [BR:nme01002]
 Metallo Peptidases
  Family M1
   NMB1416 (pepN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1449457..1452060)
Genome map
AA seq 867 aa AA seqDB search
MSKTVHYLKDYQTPAYHILKTDLHFDINEPQTVVKSRLTVEPQRVGEPLVLDGSAKLLSV
KINGAAADYVLEGETLTIAGVPSERFTVEVETEILPAENKSLMGLYASGGNLFTQCEPEG
FRKITFYIDRPDVMSKFTTTIVADKKRYPVLLSNGNKIDGGEFSDGRHWVKWEDPFSKPS
YLFALVAGDLAVTEDYFTTMSGRNVKIEFYTTEADKPKVGFAVESLKNAMKWDETRFGLE
YDLDIFMVVAVGDFNMGAMENKGLNIFNTKFVLADSRTATDTDFEGIESVVGHEYFHNWT
GNRVTCRDWFQLSLKEGLTVFRDQEFSGDRASRAVRRIENIRLLRQHQFPEDAGPTAHPV
RPASYEEMNNFYTMTVYEKGAEVVRMYHTLLGEEGFQKGMKLYFQRHDGQAVTCDDFRAA
MADANGINLDQFALWYSQAGTPVLEAEGRLKNNIFELTVKQTVPPTPDMTDKQPMMIPVK
VGLLNRNGEAVAFDYQGKRATEAVLLLTEAEQTFLLEGVTEAVVPSLLRGFSAPVHLNYP
YSDDDLLLLLAHDSDAFTRWEAAQTLYRRAVAANLATLSDGVELPKHEKLLAAVEKVISD
DLLDNAFKALLLGVPSEAELWDGAENIDPLRYHQAREALLDTLAVHFLPKWHELNRQAAK
QENQSYEYSPEAAGWRTLRNVCRAFVLRADPAHIETVAEKYGEMAQNMTHEWGILSAVNG
NESDTRNRLLAQFADKFSDDALVMDKYFALVGSSRRSDTLQQVRTALQHPKFSLENPNKA
RSLIGSFSRNVPHFHAEDGSGYRFIADKVIEIDRFNPQVAARLVQAFNLCNKLEPHRKNL
VKQALQRIRAQEGLSKDVGEIVGKILD
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaccgtgcattatctcaaagactatcaaacgcccgcctaccatattctcaaa
accgatttacattttgatattaatgaaccgcaaaccgtcgtgaagtcgcgtttgacggtt
gagccgcagagggtaggggagccgctggtgttggacggttcggcgaaactcttgtccgtc
aaaatcaacggggcggcggcggattatgtgttggaaggagagacgctgacgattgcgggc
gtgccgtccgaacgcttcaccgtcgaagtggaaaccgaaatcctgccggcggaaaacaaa
tcgctgatggggctgtatgcttccggcggcaatttgtttacccagtgcgagccggagggc
ttccgcaaaatcacattttacatcgaccgtccggatgtgatgtccaagttcaccaccacc
atcgtcgccgacaaaaaacgctatcccgttttgctttccaacggcaacaaaatcgacggc
ggcgagttttcagacggccgccattgggtgaaatgggaagacccgttttccaaaccgagc
tatctgtttgctttggtcgcgggcgatttggcggtaacggaagactatttcaccaccatg
agcggcagaaacgtcaaaatcgagttttacaccaccgaagcggacaagcccaaggtcggc
tttgccgtggaatcgttgaaaaacgcgatgaaatgggacgaaacgcgcttcggtttggaa
tacgacttggatattttcatggtcgtcgccgtgggcgatttcaatatgggcgcgatggaa
aacaagggtttgaacatctttaacaccaagttcgtccttgccgacagccgcaccgccacc
gataccgatttcgaaggcatcgaatccgtggtcggacacgagtatttccacaactggacg
ggcaaccgcgtaacctgccgcgactggttccagctttcgctgaaggaagggctgaccgtg
ttccgcgaccaagaattttccggcgaccgcgccagccgcgccgtgcgccgcatcgaaaac
atccgcctgctgcgccagcaccagttccccgaagacgcaggcccgaccgcccatccggtg
cgccccgccagctatgaggagatgaacaatttctacaccatgaccgtttatgaaaaaggc
gcggaagtagtgcggatgtatcacaccctgctcggcgaagagggcttccagaaaggcatg
aagctctatttccaacgccacgacggacaggccgttacctgcgacgatttccgcgcggcg
atggcggacgcgaacggcatcaatctcgaccagttcgccttgtggtacagccaggcgggc
acgcccgttttggaagcggaaggtcgtctgaaaaacaatattttcgagttgaccgtcaaa
caaaccgtgccgcccacgcccgatatgacggataaacagccgatgatgattcccgtcaag
gtcgggctgctgaaccgcaacggcgaagcggtggcattcgactatcagggcaaacgcgcg
accgaagccgtgttgctgctgaccgaagccgaacagaccttcctgctcgaaggcgtaacc
gaagccgtcgttccctcgctgctgcgcgggttcagcgcgccggtgcatctgaactatccg
tacagcgacgacgacctgctgctcctgctcgcccatgacagcgacgccttcacgcgctgg
gaagccgcccaaacgctctaccgccgcgccgtcgccgccaaccttgccacgctttcagac
ggcgttgagctgccgaaacacgaaaaactgcttgccgccgtcgaaaaagtcatttcagac
gacctcttagacaacgccttcaaagccctgcttttgggcgtgccatccgaagccgagctg
tgggacggcgcagaaaacatcgacccgctgcgctaccatcaggcgcgcgaagccttgttg
gatacgcttgccgtccacttcctgccgaaatggcacgaattgaaccgtcaggcggcgaag
caggaaaaccaaagctacgaatacagccccgaagccgccggctggcgcacgctgcgcaac
gtctgccgcgcctttgtcctgcgcgccgaccccgcgcacatcgaaaccgttgccgaaaaa
tacggcgaaatggcgcaaaacatgacccacgaatggggcatcctgtccgccgtcaacggc
aacgaaagcgatacgcgcaaccgcctgctggcgcagtttgccgacaagttttcagacgac
gcgctggtgatggacaaatattttgccctcgtcggctcaagccgccgcagcgacaccctg
caacaggttcgaaccgccttgcagcatccgaaattcagcctcgaaaaccccaacaaagcc
cgttcgctcatcggcagcttcagccgcaacgtcccgcatttccacgcagaagacggcagc
ggctaccgcttcatcgccgacaaagtcatcgaaatcgaccgcttcaacccgcaggtcgcc
gcccgcttagtgcaggcgttcaacctctgcaacaagctcgagccgcaccgcaaaaacttg
gtgaaacaagcattgcagcgcattcgggcgcaggaaggattgtcgaaagacgtgggcgaa
atcgtcggcaaaattttggattga

DBGET integrated database retrieval system