KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1429Help
Entry
NMB1429           CDS       T00027                                 

Gene name
porA
Definition
(RefSeq) outer membrane protein PorA
  KO
K18132  
major outer membrane protein P.IA
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Transporters [BR:nme02000]
 Other Transporters
  Pores ion channels [TC:1]
   NMB1429 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1467069..1468247)
Genome map
AA seq 392 aa AA seqDB search
MRKKLTALVLSALPLAAVADVSLYGEIKAGVEGRNYQLQLTEAQAANGGASGQVKVTKVT
KAKSRIRTKISDFGSFIGFKGSEDLGDGLKAVWQLEQDVSVAGGGATQWGNRESFIGLAG
EFGTLRAGRVANQFDDASQAIDPWDSNNDVASQLGIFKRHDDMPVSVRYDSPEFSGFSGS
VQFVPIQNSKSAYTPAYYTKNTNNNLTLVPAVVGKPGSDVYYAGLNYKNGGFAGNYAFKY
ARHANVGRNAFELFLIGSGSDQAKGTDPLKNHQVHRLTGGYEEGGLNLALAAQLDLSENG
DKTKNSTTEIAATASYRFGNAVPRISYAHGFDFIERGKKGENTSYDQIIAGVDYDFSKRT
SAIVSGAWLKRNTGIGNYTQINAASVGLRHKF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaaaacttaccgccctcgtattgtccgcactgccgcttgcggccgttgccgat
gtcagcctatacggcgaaatcaaagccggcgtggaaggcaggaactaccagctgcaattg
actgaagcacaagccgctaacggtggagcgagcggtcaggtaaaagttactaaagttact
aaggccaaaagccgcatcaggacgaaaatcagtgatttcggctcgtttatcggctttaag
gggagtgaggatttgggcgacgggctgaaggctgtttggcagcttgagcaagacgtatcc
gttgccggcggcggcgcgacccagtggggcaacagggaatcctttatcggcttggcaggc
gaattcggtacgctgcgcgccggtcgcgttgcgaatcagtttgacgatgccagccaagcc
attgatccttgggacagcaataatgatgtggcttcgcaattgggtattttcaaacgccac
gacgacatgccggtttccgtacgctacgattcccccgaattttccggtttcagcggcagc
gttcaattcgttccgatccaaaacagcaagtccgcctatacgccggcttattatactaag
aatacaaacaataatcttactctcgttccggctgttgtcggcaagcccggatcggatgtg
tattatgccggtctgaattacaaaaatggcggttttgccgggaactatgcctttaaatat
gcgagacacgccaatgtcggacgtaatgcttttgagttgttcttgatcggcagcgggagt
gatcaagccaaaggtaccgatcccttgaaaaaccatcaggtacaccgtctgacgggcggc
tatgaggaaggcggcttgaatctcgccttggcggctcagttggatttgtctgaaaatggc
gacaaaaccaaaaacagtacgaccgaaattgccgccactgcttcctaccgcttcggtaat
gcagttccacgcatcagctatgcccatggtttcgactttatcgaacgcggtaaaaaaggc
gaaaataccagctacgatcaaatcatcgccggcgttgattatgatttttccaaacgcact
tccgccatcgtgtctggcgcttggctgaaacgcaataccggcatcggcaactacactcaa
attaatgccgcctccgtcggtttgcgccacaaattctaa

DBGET integrated database retrieval system