KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1432Help
Entry
NMB1432           CDS       T00027                                 

Gene name
aroA
Definition
(RefSeq) 3-phosphoshikimate 1-carboxyvinyltransferase
  KO
K00800  
3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB1432 (aroA)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB1432 (aroA)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     NMB1432 (aroA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1471398..1472699
Genome map
AA seq 433 aa AA seqDB search
MTESVRLPVARLKPSTVALPGSKSISNRTLLLAALSDNACEIHSLLKSDDTDRMLEALDK
LGVQIEYLAEDRLKVHGTGGRFPNRTADLFLGNAGTAFRPLTAALAVLGGDYHLHGVPRM
HERPIGDLVDALRIAGADVEYLGKEHYPPLHIGERQDNGERVIPIKGNVSSQFLTALLMA
LPLTGQAFEIRMVGELISKPYIDITLKLMAQFGVQVINEGYRVFKIPADAHYHAPEHLHV
EGDASSASYFLAAGLIAATPVRVTGIGANSIQGDVAFARELEKIGADVVWGENFVEVSRP
KERAVQSFDLDANHIPDAAMTLAIVALATGQTCTLRNIGSWRVKETDRIAAMANELRKLG
AKVVEEAEAIHITPPETLTPDAVIDTYDDHRMAMCFSLVSLLGVPVVINDPKCTHKTFPT
YFDVFSSLTETAE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatccgtccgcctccccgtcgcccgtctcaaaccttccaccgtcgccctgccc
ggctccaaaagcatcagcaaccgcaccctgctgcttgccgccttgtccgacaatgcttgc
gaaatccattccctgctcaaatccgacgataccgaccgtatgctcgaagcactcgataaa
ctcggcgttcaaatcgaatatcttgccgaagaccgtctgaaagtgcacggcacaggcgga
cgcttccccaaccgcactgccgatttgtttttgggcaacgcgggcacggcgttccgcccg
ttaaccgccgctctggccgttttgggcggcgattatcatctgcacggcgtgcctcgtatg
cacgaacgtcctatcggcgatttggtcgatgcgttgcggattgccggggccgatgtcgaa
tatctcggcaaggaacactatccgccgcttcatatcggcgaacgccaagacaacggcgag
cgcgtgattccgattaaaggcaatgtgtccagccagtttctgaccgcccttttaatggcg
ttgccgctgaccgggcaggcgtttgaaatccgtatggtcggcgaattgatttccaagccc
tatatcgacattactttaaaactgatggcgcaattcggcgtacaggttatcaatgaaggc
taccgcgtcttcaaaattcccgccgatgcgcactaccacgcgcccgaacacttgcacgtc
gaaggcgatgcctccagcgcgtcctacttcctcgcagccggtttgattgccgccacgccc
gtccgcgttaccggtatcggcgcaaacagcatacagggcgatgtcgcctttgcccgcgag
ctggaaaaaatcggggcggacgtggtttggggcgaaaacttcgtcgaagtttcacgcccg
aaggaacgtgccgtccaatcctttgatttggatgcgaaccatatccccgatgccgccatg
accctcgccatcgtcgcgcttgctacagggcaaacctgcacgctgcgcaacatcggttcg
tggcgcgtcaaagaaaccgaccgcatcgccgcaatggcaaacgagttgcgcaaactcggg
gcaaaagtcgtcgaagaagccgaagcaattcacatcaccccgcccgaaacgctgacaccc
gacgccgtcatcgacacgtacgacgaccaccgcatggcgatgtgtttctcgctggtttcg
ctgttgggcgtacccgtcgtcatcaacgatccgaaatgcacccacaaaaccttcccgact
tatttcgacgtgttctcatcgctgaccgaaacagcggaataa

DBGET integrated database retrieval system