KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1457Help
Entry
NMB1457           CDS       T00027                                 

Gene name
tktA
Definition
(RefSeq) transketolase
  KO
K00615  
transketolase [EC:2.2.1.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB1457 (tktA)
   01230 Biosynthesis of amino acids
    NMB1457 (tktA)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB1457 (tktA)
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    NMB1457 (tktA)
Enzymes [BR:nme01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     NMB1457 (tktA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1504457..1506436
Genome map
AA seq 659 aa AA seqDB search
MSQLANAIRFLSADAVQKANSGHPGAPMGMAEMAETLWTKFLNHNPANPKFYNRDRFVLS
NGHASMLLYSLLHLTGYNLSIEDLKNFRQLHSKTPGHPEYGYTDGVETTTGPLGQGIANA
VGMALAEKILAAEFNKDGLNIVDHYTYVFMGDGCLMEGVSHEACSLAGTLGLGKLIVLYD
DNNISIDGKVDGWFTENIPQRFESYGWHVVPNVNGHDTAAIQAAIEAARAETGKPSIICC
KTLIGKGSANKEGSHKTHGAPLGADEIEATRKHLGWTYPAFEIPQEIYDAWNAKEQGAKL
EADWNELFAQYQAKYPAEAAEFVRRMDKKLPDNFDEYVQAALKEVCAKAETIATRKASQN
SIEILAKELPELVGGSADLTPSNLTDWSNSVSVTRDKGGNYIHYGVREFGMGAIMNGLVL
HGGVKPFGATFLMFSEYERNALRMAALMKINPVFVFTHDSIGLGEDGPTHQPIEQTATLR
LIPNMDVWRPCDTAESLVAWAEAVKAADHPSCLIFSRQNLKFQARSEQQLNDIKRGGYVI
SEAQGNAQAVIIATGSEVELALEAQKALAAQNIAVRVVSMPSTNVFDRQDAAYQAAVLPE
GLPRIAVEAGHADGWYKYVGLNGAVVGINRFGESAPADLLFKAFGFTVDNVVDTVKSVL
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaactggcaaacgcaatccgcttcctctcggccgatgccgttcaaaaagccaat
tccggccaccccggcgcgcctatgggtatggcggaaatggcggaaacattgtggacgaaa
ttcctcaatcacaaccccgccaaccccaaattctacaaccgcgaccgcttcgtcctctcc
aacggccacgcgtctatgctgttgtacagcctgctgcacctgaccggctacaacctaagc
attgaagacttgaaaaacttccgccaactgcacagcaaaacccccggccatcccgaatac
ggctacaccgacggcgtggaaaccacgaccggcccgttggggcaagggattgccaacgcg
gtgggtatggcattggcagaaaaaatccttgccgccgaatttaataaagacggtttgaac
atcgtcgatcattacacctacgtctttatgggcgacggctgtctgatggaaggcgtatcg
cacgaagcctgttcgctcgccggcaccttgggcttgggcaaactgattgttttatatgat
gacaacaatatttccattgatggtaaagtggacggctggtttaccgaaaacatcccgcaa
cgctttgaaagctacggctggcacgtcgttcccaatgtaaacggtcatgacaccgccgcc
attcaagccgccatcgaagccgcacgtgccgaaaccggcaaaccgtccatcatctgctgc
aaaaccttaatcggcaaaggcagtgccaacaaagaaggcagccacaaaacccacggcgca
cctttgggcgcggacgaaatcgaagccacgcgcaaacatttgggctggacttaccccgcc
tttgaaatcccgcaagaaatttacgatgcgtggaatgccaaagaacaaggcgcgaaactg
gaagccgactggaacgaactgttcgcgcaatatcaagccaaatatcctgccgaagccgca
gaatttgtgcgccgtatggataaaaagctgccggacaatttcgatgaatacgttcaagcc
gcattgaaagaagtgtgcgccaaagccgaaaccatcgccacccgcaaagccagccaaaac
agcatcgaaatcttggcaaaagagttgcctgaattggtaggcggttctgccgacctgacc
ccgtccaatctgaccgactggtcaaacagcgtctccgttacccgcgacaaaggcggcaac
tacatccactacggcgtgcgcgagttcggcatgggtgcgattatgaacggtttggtattg
cacggcggcgtaaaacccttcggcgcgactttcctgatgttcagcgaatacgagcgcaat
gccctgcgtatggctgcgttgatgaaaatcaaccctgtatttgtgtttacccacgattcc
atcggtttgggcgaagacggcccgacccatcaaccgattgagcaaaccgccaccctgcgc
ctgattccgaatatggacgtatggcggccgtgcgacaccgccgaatccttggtggcttgg
gcagaagccgtcaaagccgccgatcacccgtcctgcctgattttcagccgtcaaaacctg
aaattccaagcgcgcagcgagcaacaactgaacgacatcaaacgcggcggctacgtcatc
agcgaagcccaaggcaacgcccaagccgtcatcattgccaccggctcagaagtcgagctg
gctttggaagcgcaaaaagccctcgccgcgcaaaacatcgccgtgcgcgtcgtttccatg
ccgtccaccaacgtattcgaccgccaagacgccgcctatcaagccgccgtcctgcccgaa
ggcctgccgcgcatcgccgtagaagccggacacgccgacggctggtacaaatatgtcgga
ctgaacggcgcagtcgtcggcatcaaccgcttcggcgaatccgcccctgccgatttactc
ttcaaagcattcggctttaccgtggacaatgtggttgatacggtgaaatccgtgctgtaa

DBGET integrated database retrieval system