KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1467Help
Entry
NMB1467           CDS       T00027                                 

Gene name
ppx
Definition
(RefSeq) exopolyphosphatase
  KO
K01524  
exopolyphosphatase / guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase [EC:3.6.1.11 3.6.1.40]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB1467 (ppx)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.11  exopolyphosphatase
     NMB1467 (ppx)
    3.6.1.40  guanosine-5'-triphosphate,3'-diphosphate phosphatase
     NMB1467 (ppx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1516525..1518033
Genome map
AA seq 502 aa AA seqDB search
MTTTPANVLASVDLGSNSFRLQICENNNGQLKVIDSFKQMVRFAAGLDEQKNLSAASQEQ
ALDCLAKFGERLRGFRPEQVRAVATNTFRVAKNIADFLPKAEAALGFPIEIIAGREEARL
IYTGVIHTLPPGGGKMLVIDIGGGSTEFVIGSTLNPDITESLPLGCVTYSLRFFQNKITA
KDFQSAISAARNEIQRISKNMRREGWDFAVGTSGSAKSIRDVLAAEMPQEADITYKGMRA
LAERIIEAGSVKKAKFENLKPERIEVFAGGLAVMMAAFEEMKLDRMTVTEAALRDGVFYD
LIGRGLNEDMRGQTVAEFQHRYHVSLNQAKRTAETAQTFMDSLCHAKNVTVQELALWQQY
LGRAAALHEIGLDIAHTGYHKHSAYILENADMPGFSRKEQTILAQLVIGHRGDMKKMSGI
IGTNEMLWYAVLSLRLAALFCRSRQDLSFPKNMQLRTDTESCGFILRIDREWLERHPLIA
DALEYESVQWQKINMPFKVEAV
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacccccgcaaacgtcctcgcctccgtcgatttgggttccaacagtttccgc
ctccagatttgcgaaaacaacaacggacaattaaaagtcatcgattcgttcaaacagatg
gtgcgcttcgccgccggactggacgaacagaaaaatctgagtgccgcttcccaagaacag
gctttggactgtctggcaaaattcggcgaacgcctgcgcggcttccgccctgaacaggta
cgcgccgtggcaaccaacacattccgcgttgccaaaaacatcgcagatttccttcccaaa
gccgaagcggcattgggtttccccatcgaaatcatcgccgggcgcgaagaggcgcggctg
atttataccggcgtgatccacaccctccccccgggcggcggcaaaatgctggttatcgac
atcggcggcggttcgacagaatttgtcatcggctcgacgctgaatcccgacattaccgaa
agcctgcccttgggctgcgtaacctacagcctgcgcttcttccaaaacaaaatcaccgcc
aaagacttccaatctgccatttccgccgcccgcaacgaaatccagcgtatcagcaaaaat
atgaggcgcgaaggttgggatttcgccgtcggcacatcgggttcggcaaaatccatccgc
gacgtgcttgccgccgaaatgccccaagaggcggacattacctacaaaggcatgcgcgcc
ctcgccgaacgcatcatcgaagccggttcggtcaaaaaagccaaatttgaaaacctgaaa
ccggaacgcatcgaagtttttgccggcggacttgccgtgatgatggcggcgtttgaggaa
atgaaactcgacaggatgaccgtaaccgaagccgccctgcgcgacggcgtgttttacgat
ttgatcgggcgcggtttaaacgaagatatgcgcggacaaacggttgccgagttccaacac
cgctaccacgtcagcctcaatcaggcgaaacgcaccgccgagaccgcgcaaacctttatg
gacagcctctgccacgctaaaaacgttacagttcaagagcttgccttgtggcaacagtat
ctcggacgcgccgccgcgctgcacgaaatcggtttggacatcgcccacaccggctatcac
aagcattccgcctacatcctcgaaaacgccgatatgccgggtttctcacgcaaagaacag
accatacttgcccaactggtcatcggtcatcgcggcgatatgaaaaaaatgagcggcatc
atcggcaccaacgaaatgttgtggtatgccgttttgtccctgcgccttgccgcactgttc
tgccgttcgcgccaagacctgtctttcccgaaaaatatgcagttgcgcacggatacggaa
agctgcggcttcatcctgcgtattgacagggaatggctggaacgccatcccctgattgcc
gacgcattggaatatgaaagcgtccaatggcaaaaaatcaatatgccgttcaaagtcgag
gccgtctga

DBGET integrated database retrieval system