KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1476Help
Entry
NMB1476           CDS       T00027                                 

Gene name
gluD
Definition
(RefSeq) glutamate dehydrogenase
  KO
K00260  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    NMB1476 (gluD)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB1476 (gluD)
   00220 Arginine biosynthesis
    NMB1476 (gluD)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NMB1476 (gluD)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     NMB1476 (gluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1526157..1527422)
Genome map
AA seq 421 aa AA seqDB search
MSEALAKETLNPFEIARKQVKTACDRLKTDPAVYEILKSPTRVLEVNFPVKLDDDTVKTF
TGYRSQHNNAVGPYKGGVRFHPSVNLDEVKALSIWMTIKCCVAGIPYGGGKGGITLDPRD
YSEAELERIARAYAEAIAPLIGEKIDIPAPDVNTNGKIMSWMVDAYENVVKHSAPGVFTG
KPVEFGGSLARTEATGYGVNLAAVQALEKLGKDVKGATYAIQGFGNVGYHTGYYAHQSGA
KVVAVSTVDVAIYNENGLDMEALFKEFQEKGFITNEAGYGKEITNAELLALDVDVLAPCA
LENQLTSENAGKVRAKIVVEGANGPTTPEADVILRQNGVLVVPDILANCGGVVVSYFEWV
QNLQGYYWEFDEVQEKETVVLRRAFRDIWNLAQEYDVDLRTASYMMSIRRVEKAMKLRGW
Y
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagcccttgcaaaagaaaccctcaatccgtttgaaatcgcgcgcaaacaggtg
aaaaccgcctgtgaccggctgaaaaccgatccggccgtttatgaaatcctgaagagtccg
acccgcgtgttggaagtcaattttcccgtcaaactcgacgacgacacggtcaaaaccttc
acgggctaccgttcgcaacacaacaacgccgtcggcccctataaaggcggcgtgcgcttc
catcccagtgtgaatttggacgaagtcaaagccctgtcaatttggatgaccatcaaatgc
tgcgttgcgggtattccttacggcggcggcaaaggcggcattaccttggatccgcgcgat
tattccgaggcggaactggaacgcatcgcccgcgcttatgctgaagcgattgccccgctg
attggcgagaaaatcgatattcccgcccccgatgtgaataccaacggcaaaattatgtcg
tggatggtggatgcttatgaaaacgtggtgaaacattccgcgccgggcgtatttaccgga
aaaccggttgagttcggcggctctttggcgcgtaccgaggctaccggttacggcgtgaac
ctcgccgccgtccaagctttggaaaaactgggcaaggacgtgaagggtgccacttacgcc
attcaaggtttcggtaatgtgggttaccacacaggttattacgcgcatcaatccggcgcg
aaagttgttgcggtttctactgttgacgttgccatttacaacgaaaacggtttggatatg
gaagctttgtttaaagagttccaagaaaaaggcttcatcaccaacgaagccggttacggc
aaagaaattaccaacgccgaacttttggctttggatgtggacgtactcgccccttgcgcg
ctggaaaaccaactgacttccgaaaacgccggtaaagtccgcgcgaaaatcgtagtcgaa
ggcgcgaacggcccgactacgcccgaagccgacgtgatcctgcgtcaaaacggcgtattg
gtcgtgcctgatattctggcgaactgcggcggcgtggtcgtttcctatttcgagtgggtg
caaaacctgcaaggctattattgggagtttgacgaagttcaagagaaagaaaccgtcgtc
ctgcgacgcgcgttccgcgatatatggaacttggcgcaagagtatgatgtcgatttgcga
accgcgtcttacatgatgagtatccgccgtgttgaaaaagcgatgaaactgcgcggttgg
tattga

DBGET integrated database retrieval system