KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1484Help
Entry
NMB1484           CDS       T00027                                 

Gene name
surE
Definition
(RefSeq) 5'-nucleotidase SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00230  Purine metabolism
nme00240  Pyrimidine metabolism
nme00760  Nicotinate and nicotinamide metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB1484 (surE)
   00240 Pyrimidine metabolism
    NMB1484 (surE)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NMB1484 (surE)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     NMB1484 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-GeneID: 903906
NCBI-ProteinID: NP_274492
UniProt: Q9JYP8
Position
complement(1531793..1532539)
Genome map
AA seq 248 aa AA seqDB search
MNVLISNDDGYLSEGIAVLARVTAEFANVRVVAPERDRSGVSNSLTLERPLQLKQAQNGF
YYVNGTPTDCIHIGQSVFSDFQADFVFSGINRGANMGDDTLYSGTVAAATEAYLMGIPAV
AFSLNDASGRYWATAEQALWTLLAHFFKNPPQSPILWNINIPAVAPEDVRGIKIARLGRR
HHGQNVIPARNPRGEQIYWIGPVGEVSDREEGTDFGECGAGFITVTPLQIDLTAYPDMAE
TAAFWHAD
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttttgatttccaacgacgacggctacctctccgaaggcattgccgttttggcg
cgcgttacggcggaatttgccaacgtcagggtggtcgcgcccgaacgcgacaggagcggg
gtcagcaattcgctgacgctggaacgccctttgcagttgaaacaggcgcaaaacgggttc
tactatgtcaacggcacgccgaccgactgcatccacatcgggcagtctgtattttcggat
tttcaggccgattttgtcttttcgggcatcaaccggggcgcgaatatgggggacgacacg
ctttattcggggacggttgcggcggcaaccgaagcctaccttatgggcatacccgccgtg
gcgttttccttaaacgacgcttccggacgctattgggcgaccgcagaacaggcactgtgg
acattgttggcgcattttttcaaaaaccccccgcagtcccctattttgtggaacatcaat
atccccgccgttgcgccggaagatgtgcggggcattaaaatcgcccgtttgggcaggagg
catcacggtcagaacgtcattcccgcgcgcaatccgcgcggcgaacagatttattggata
ggaccggtcggcgaagtttccgatcgggaagagggaacggatttcggtgaatgcggcgca
ggtttcattaccgtaacgccgctgcaaatcgacctgaccgcctatccggacatggcggaa
acagcggcgttctggcatgcggactga

DBGET integrated database retrieval system