KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1484Help
Entry
NMB1484           CDS       T00027                                 

Gene name
surE
Definition
(RefSeq) 5'-nucleotidase SurE
  KO
K03787  
5'-nucleotidase [EC:3.1.3.5]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB1484 (surE)
   00240 Pyrimidine metabolism
    NMB1484 (surE)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NMB1484 (surE)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     NMB1484 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1531793..1532539)
Genome map
AA seq 248 aa AA seqDB search
MNVLISNDDGYLSEGIAVLARVTAEFANVRVVAPERDRSGVSNSLTLERPLQLKQAQNGF
YYVNGTPTDCIHIGQSVFSDFQADFVFSGINRGANMGDDTLYSGTVAAATEAYLMGIPAV
AFSLNDASGRYWATAEQALWTLLAHFFKNPPQSPILWNINIPAVAPEDVRGIKIARLGRR
HHGQNVIPARNPRGEQIYWIGPVGEVSDREEGTDFGECGAGFITVTPLQIDLTAYPDMAE
TAAFWHAD
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttttgatttccaacgacgacggctacctctccgaaggcattgccgttttggcg
cgcgttacggcggaatttgccaacgtcagggtggtcgcgcccgaacgcgacaggagcggg
gtcagcaattcgctgacgctggaacgccctttgcagttgaaacaggcgcaaaacgggttc
tactatgtcaacggcacgccgaccgactgcatccacatcgggcagtctgtattttcggat
tttcaggccgattttgtcttttcgggcatcaaccggggcgcgaatatgggggacgacacg
ctttattcggggacggttgcggcggcaaccgaagcctaccttatgggcatacccgccgtg
gcgttttccttaaacgacgcttccggacgctattgggcgaccgcagaacaggcactgtgg
acattgttggcgcattttttcaaaaaccccccgcagtcccctattttgtggaacatcaat
atccccgccgttgcgccggaagatgtgcggggcattaaaatcgcccgtttgggcaggagg
catcacggtcagaacgtcattcccgcgcgcaatccgcgcggcgaacagatttattggata
ggaccggtcggcgaagtttccgatcgggaagagggaacggatttcggtgaatgcggcgca
ggtttcattaccgtaacgccgctgcaaatcgacctgaccgcctatccggacatggcggaa
acagcggcgttctggcatgcggactga

DBGET integrated database retrieval system