KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1488Help
Entry
NMB1488           CDS       T00027                                 

Gene name
gabD
Definition
(RefSeq) succinate semialdehyde dehydrogenase
  KO
K00135  
succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Tyrosine metabolism
Butanoate metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    NMB1488 (gabD)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB1488 (gabD)
   00310 Lysine degradation
    NMB1488 (gabD)
   00350 Tyrosine metabolism
    NMB1488 (gabD)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NMB1488 (gabD)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     NMB1488 (gabD)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     NMB1488 (gabD)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     NMB1488 (gabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1535377..1536810)
Genome map
AA seq 477 aa AA seqDB search
MNEYSQLIKHPDISLPPVSDGIKVDNPATGETLAFVRKTDSDKLKNLIQKAAAAQKLWAA
KTALERADVLWRWYFQIKENKEALARLMTMEQGKSLTEARGEIDYAASFVRWFAEEARRI
DGDVLTSVKASQKLVVLKQPVGVTAAITPWNFPSAMIARKAAPALAVGCAMIVKPASLTP
LSAYALASLAYEAGIPQDLLPVVSGSASEIGHEFATNPIIRKISFTGSTEVGAKIFADSA
ADIKKLSLELGGNAPFIVFDDADLDKAVEGALASKFRNSGQTCVCTNRVYAQSAIYDEFC
RKLSEKAAALKLGNGLEDGVNQGPLIEEKAVEKVEQHIADALAKGASCLTGGKRSALGGT
FFEPTVLSGVTAQMAVAREETFGPLCPVFRFETEAEVIEAANNTEYGLAAYLFTADTARQ
WRVGEALEYGMVGINTGLISNEAAPFGGVKRSGLGREGSKYGADEYLELKYLCMDVG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaatattcccaattaatcaagcatcccgatatttcccttcccccggtttcagac
ggcatcaaagtcgataatccggcaacgggcgagactttggcgtttgtccgcaagacggat
tcggacaagctgaaaaacctgattcaaaaagcagctgcagcacaaaaattatgggcggca
aaaactgcgttggaacgcgccgatgtgttgtggcgttggtattttcagattaaagaaaac
aaagaagcattagcgcgcctgatgacgatggagcagggcaaaagcctgaccgaggcgcgt
ggcgaaatcgattatgcggcttcgtttgtgcgctggtttgccgaagaggcgcggcggatt
gacggcgatgtgctgacgagtgtgaaagcgtcgcaaaaactggtcgtgttgaaacagccc
gtcggcgttaccgctgcgattacgccgtggaactttccgtccgcgatgattgcgcgcaag
gccgcgcctgctttggcggtgggttgcgcgatgatcgtcaaacccgcatcgctcacgcct
ttgagtgcgtatgccttggcttcgttggcttacgaagcgggcataccgcaggatttgttg
cctgttgtcagcggcagtgcttcggaaatcggccatgaatttgctacgaacccgattatc
cgcaaaatcagcttcaccggctcgaccgaagtcggcgcaaaaatttttgccgacagcgcg
gcggacattaaaaaactcagtttggagctgggcggcaacgcgccgtttatcgtgtttgac
gatgccgatttggacaaagccgtcgaaggcgcgctcgccagcaagttccgtaacagcggt
cagacctgcgtctgcaccaaccgcgtttacgctcaatccgccatttacgacgaattttgc
cgcaaattgagtgaaaaagcagccgcgctcaaattgggcaacggcttggaggatggtgtg
aaccaagggccgctgattgaggaaaaagcggtggagaaagtcgagcagcacatcgccgac
gcgcttgctaaaggtgcaagctgcctgaccggcggcaaacgcagcgcgttgggcggaacg
tttttcgaaccgactgttttaagcggcgtaacggcgcaaatggcggtggcacgcgaagaa
accttcgggccgttgtgtccggtattccgttttgaaaccgaagccgaggtcatcgaggct
gcgaacaatacggaatacggtttggcagcttaccttttcaccgccgacaccgcccgccaa
tggcgcgtcggcgaagccttggaatacggtatggtcggcatcaatacgggcttaatcagc
aatgaagcggcaccgttcggcggcgtgaaacgtagcggtttgggacgtgaaggcagcaaa
tacggtgcggacgaatatctagaattgaaatatctgtgtatggatgtcgggtga

DBGET integrated database retrieval system