KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1498Help
Entry
NMB1498           CDS       T00027                                 

Gene name
lysC
Definition
(RefSeq) aspartate kinase
  KO
K00928  
aspartate kinase [EC:2.7.2.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Monobactam biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    NMB1498 (lysC)
   01230 Biosynthesis of amino acids
    NMB1498 (lysC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB1498 (lysC)
   00270 Cysteine and methionine metabolism
    NMB1498 (lysC)
   00300 Lysine biosynthesis
    NMB1498 (lysC)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    NMB1498 (lysC)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     NMB1498 (lysC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1548041..1549258)
Genome map
AA seq 405 aa AA seqDB search
MALIVHKYGGTSVGSPERIKNVAKRVAKARAEGHDIVVVVSAMSGETNRLVALAHEMQEH
PDPRELDVVLATGEQVTIGLLAMALKDIGVDAKSYTGWQVALKTDTAHTKARIESIDDEK
MRADLTAGKVVIVAGFQGISSEGDISTLGRGGSDTSAVALAAALKADECQIYTDVDGVYT
TDPRVVPEARRMDTVTFEEMIELASLGSKVLQIRSVEFAGKYKVRLRVLSSLQDGGNGTL
ITFEEDDNMERAAVTGIAFDKNQARINVRGVPDKPGVAYQILGAVADANIEVDMIIQNVG
SEGTTDFSFTVPRGDYKQTLEILSERQDSIGAASIDGDDTVCKVSAVGLGMRSHVGVAAK
IFRTLAEEGINIQMISTSEIKVSVLIDEKYMELATRVLHKAFNLG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgttaatcgtacataaatacggcggcacatcagtaggctcgcccgaacgcatcaaa
aacgtagccaaacgtgtcgccaaagcccgcgccgaaggacacgacatcgtagtcgtcgta
tccgccatgagcggcgaaaccaaccgactggtcgcactggcgcacgaaatgcaagagcat
cccgatccgcgcgagctggacgtcgtcttagctaccggcgaacaagtaaccatcggcctt
ttggcgatggcattgaaagacatcggcgtggatgccaaaagctacacaggctggcaggtc
gccctcaaaaccgataccgcccacaccaaagcccgcatcgaaagcattgatgacgaaaaa
atgcgtgccgaccttaccgccggcaaagtcgtcatcgttgccggcttccaaggcatcagc
agtgaaggcgatatttccacgctcggacgcggcggttccgacacttccgccgtcgcgctt
gccgccgcgctcaaagccgacgagtgccaaatctataccgacgtagacggcgtttacaca
accgacccccgcgtcgtacccgaagcgcgccgcatggatacggttacatttgaagaaatg
atcgaactggcaagcctcggttcgaaagttttgcaaatccgttcagtagaattcgccgga
aaatacaaagtgcgcctgcgcgtactgagcagcctgcaagacggcggcaatggcacctta
attacctttgaagaggacgacaacatggaaagagctgccgtaaccggtatcgcattcgat
aaaaaccaagcccgcatcaacgtgcgcggcgtacccgacaaacctggcgtcgcctatcag
attttaggcgcggttgccgatgccaacatcgaagtcgatatgattatccaaaatgtcggc
agcgaaggcacaaccgatttttcctttaccgtaccgcgcggcgattacaagcagactttg
gaaatcctgtcggaacgccaagacagtatcggcgcggcttctattgatggcgacgacacc
gtatgcaaagtctccgcagtcggtttgggtatgcgttcgcacgtcggtgtagccgccaaa
atcttccgcacgctcgccgaagagggtatcaacatccaaatgatttccacctccgaaatc
aaagtttccgtattgattgatgaaaaatacatggaactggcaaccagggtattgcataaa
gcctttaatttgggctga

DBGET integrated database retrieval system