KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1505Help
Entry
NMB1505           CDS       T00027                                 

Gene name
pncB
Definition
(RefSeq) nicotinate phosphoribosyltransferase
  KO
K00763  
nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NMB1505 (pncB)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.21  nicotinate phosphoribosyltransferase
     NMB1505 (pncB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1553639..1554847
Genome map
AA seq 402 aa AA seqDB search
MTGIIHSLLDTDLYKFTMLQVVLHQFPQTHSLYEFRCRNASTVYPLADIREDLEAELDAL
CQLRFTHDELGYLRSLRFIKSDFVDYLELFQLQRRFVEIGTDDKDRLNIRIEGPMIQAMF
FEIFILAIVNELYFRRLETPAVIEEGERRLQAKAARLKEIAAAQNPDEPPFLISDFGTRR
RYKLAWQEHVIRTLLEAAPGIVRGTSNVFLAKKLGITPIGTMAHEFLQAFQALDVRLRNF
QKAALESWVHEYRGDLGVALTDVVGMDAFLRDFDLYFAKLFDGLRHDSGDPYVWGDKAYA
HYQKLKIDSRTKMLTFSDGLDIERSWALHQYFKDRFKTGFGIGTNLTNDMGHTPLNIVLK
LVECNGQSVAKLSDSPGKTMTNNSTFLAYLRQVFDVPEPETP
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcatcatacattcgctgcttgacaccgacctctacaaattcactatgctgcaa
gtggttctgcaccagtttccgcagacgcacagcctttacgaattccgctgccgcaacgcc
tcgaccgtctatccgcttgccgacatcagggaagacttggaagccgaactcgacgcgctc
tgccaactacgcttcacccacgacgaactcggctatctgcgctccctgcgtttcattaaa
agcgactttgtcgattatctcgaactcttccagctccaacgccgctttgtcgaaatcggc
acagacgataaagaccgtctgaacatccgcatcgaaggtccgatgatacaggcgatgttt
tttgaaatcttcatcctcgccattgtcaacgaactttacttccgccgcctggaaacccct
gcagtcatagaagaaggcgaacgccggcttcaagccaaagccgcgcgcctcaaagaaatc
gccgccgcacaaaaccccgacgaaccgcccttcctgatttccgacttcggcacgcgccgc
cgctacaagctcgcgtggcaggaacacgtcatccgcaccctgcttgaagccgcccccggc
atcgtacgcggcaccagcaatgtctttctcgccaaaaaactcggcatcacccccatcggc
accatggcgcacgagttcctgcaggcattccaggccctcgacgtacgcctgcggaatttc
caaaaggccgcgctcgaaagctgggtgcacgaataccggggcgatttgggcgttgccctg
accgacgtggtcggtatggatgccttcctgcgcgatttcgacctctatttcgccaaactt
ttcgacgggctgcgccacgacagcggcgacccttacgtttggggcgacaaagcctacgcc
cactatcaaaagctcaaaatcgacagccgcaccaaaatgctgaccttctccgacgggctg
gacatcgaacgctcttgggcattgcaccaatatttcaaagaccgcttcaaaaccggcttc
ggcatcggcaccaacctcaccaacgatatggggcatacgcccttgaatatcgtcttgaaa
ctggtcgaatgcaacgggcagtccgtcgccaagctgtccgactctccgggcaaaaccatg
accaacaacagcaccttcctcgcctacctgcgccaagtgttcgacgtacccgaacccgaa
acgccgtaa

DBGET integrated database retrieval system