KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1511Help
Entry
NMB1511           CDS       T00027                                 

Gene name
rpiA
Definition
(RefSeq) ribose-5-phosphate isomerase A
  KO
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB1511 (rpiA)
   01230 Biosynthesis of amino acids
    NMB1511 (rpiA)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB1511 (rpiA)
Enzymes [BR:nme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     NMB1511 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1561301..1561972)
Genome map
AA seq 223 aa AA seqDB search
MTTQDELKRIAAEKAVEFVPENEYIGIGTGSTINFFIEALGKSGKKIKGAVSTSKKSGEL
LAQYDIPVVSLNEVSGLAVYIDGADEVNHALQMIKGGGGAHLNEKIVASASEKFICIADE
SKYVSRLGKFPLPVEVVESARSLVSRKLLAMGGQPELRIGYTTFYGNQIVDVHGLNIDQP
LTMEDEINKITGVLENGIFARDAADVLILGTEEGAKVIYPCQG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacaagacgaactcaagcgcatcgccgccgaaaaagcagtcgaattcgtaccc
gaaaatgaatatatcggcatcggtaccggctcgaccatcaactttttcatcgaagccttg
ggtaagagcggcaaaaaaatcaaaggcgcggtatctacttccaaaaaatccggcgaactg
cttgcccagtacgatattcccgtcgtttctttgaacgaagtatcggggttggcggtctat
atcgacggtgcggatgaagtgaaccacgccctgcaaatgattaaaggcggtggcggcgcg
cacctcaacgaaaaaatcgtcgccagcgcgtccgaaaaattcatctgcattgcggatgaa
agcaaatatgtttcacgtttgggcaaattccctctgcctgtggaagtcgtcgaaagcgcg
cgctctcttgtttcgcgcaaactgctcgctatgggcggacagcccgaactgcgtatcggc
tacaccacgttttacggcaaccaaatcgtcgatgtccacggcttgaatatcgatcagccg
ctgacgatggaagacgaaatcaacaaaatcaccggcgtgctcgaaaacggcatattcgcc
cgcgatgccgccgatgtgttgattttggggacggaagagggtgcgaaagtcatctatccc
tgccaagggtaa

DBGET integrated database retrieval system