KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1512Help
Entry
NMB1512           CDS       T00027                                 

Gene name
ispF
Definition
(RefSeq) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
  KO
K01770  
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:4.6.1.12]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMB1512 (ispF)
Enzymes [BR:nme01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.12  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
     NMB1512 (ispF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1562049..1562531)
Genome map
AA seq 160 aa AA seqDB search
MTNIRIGQGYDVHQLTEGRKLILGGVEIPFEKGLLGHSDADALLHAVTDALLGAAGLGDI
GSHFPDTAAEFKDADSRVLLRAAYQSVQAQGWQAVNVDTTVIAQKPKLAPHIPQMRANIA
ADLGIDISCVNIKGKTNEKLGYLGRMEGIEAQAAVLLVRI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacatccgtatcggacagggctacgatgtccaccaactgaccgaaggcagaaag
ctgatacttggcggagttgaaatcccatttgaaaaagggctgctcggacactccgatgcc
gatgcgctgctgcacgccgttaccgacgcgctgctcggtgcggcaggtttgggcgatatc
ggcagccatttccccgacaccgccgcagagttcaaagatgcggacagccgcgtccttttg
cgtgcggcgtatcaaagcgttcaggcgcagggttggcaggcggtcaatgtcgatacgacc
gtgattgcacagaaacccaaactcgcgccgcacattccgcaaatgcgtgccaacatcgcc
gccgatttgggcatagacatttcgtgcgtcaacatcaaaggcaaaaccaacgaaaaactc
ggctatctcgggcggatggaaggcatagaggcgcaggcggcggtattgctggtacgcatt
tga

DBGET integrated database retrieval system