KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1554Help
Entry
NMB1554           CDS       T00027                                 

Gene name
pyrG
Definition
(RefSeq) CTP synthetase
  KO
K01937  
CTP synthase [EC:6.3.4.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NMB1554 (pyrG)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     NMB1554 (pyrG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1612288..1613922)
Genome map
AA seq 544 aa AA seqDB search
MTKFIFVTGGVVSSLGKGIAAASIAAILESRGLNVTMLKLDPYINVDPGTMSPFQHGEVF
VTDDGAETDLDLGHYERFIDSTMTRRNSFSTGQVYENVIAKERRGDYLGGTVQVIPHITD
EIKRRIHEGAAGYDVAIVEIGGTVGDIESLPFLEAIRQMRSQLGRNNTLFAHLSYVPYIA
AAGEIKTKPTQHTVKEMLSIGLQPDILICRMDRTMPADERRKIALFCNVEERAIVGSYDV
DSIYECPEMLHDQGIDNIITEQLQLNVQQADLTAWKKIVHAIQNPKHTVKIAMVGKYVDL
TESYKSLIEALKHAGIHTETDVQITFVDSENIEKNKGDVSMLKDMDAILVPGGFGSRGVE
GKIAAVRYARENNVPYLGICLGMQIALIEYARDVAGLKGANSTEFDLKCAAPVVALIDEW
QTADGSVETRDESTDLGGTMRLGAQEVELKAGSLAAKIYGSGHIRERHRHRYEVNNNYVP
TLEQAGLVIGGVSAGRERLVETIELPNHPWFFACQFHPEFTSNPRKGHPLFTAFVKAALN
NKKA
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattcattttcgtcaccggcggcgttgtctcctcactgggtaaaggtatcgcc
gccgcttctattgccgccatcctcgaatcgcgcggcttgaacgttaccatgctcaagctc
gatccttatatcaacgtcgatcccggcacgatgagcccgttccaacacggcgaagtgttc
gtaaccgacgacggcgcggaaaccgacctcgacttgggacactacgaacgctttatcgat
tccacgatgacccgccgcaacagcttcagcacgggacaggtgtacgaaaacgttatcgcc
aaagaacgacggggcgactacctcggcggtacggttcaagtcattccgcacattaccgac
gaaatcaaacgacgcatccacgaaggcgcggcaggttacgatgtggcgattgtcgaaatt
ggcggcacggtcggcgacatcgaatcgctgccgtttttggaagccatccgccagatgcga
agccagttggggcgcaacaacaccttgtttgcccacttgagctacgtcccctacatcgcc
gccgcaggcgaaatcaaaaccaagccgacccagcacaccgttaaagaaatgttgagcatc
ggtttgcaacccgacatcctgatttgccgtatggacaggacaatgcctgcggacgaacgc
cgcaaaatcgccttgttctgcaacgtggaagaacgcgcgattgtcggcagctacgatgtg
gacagcatctacgaatgccccgaaatgctgcacgaccaaggcatcgacaacatcattacc
gagcagttgcagcttaatgtgcagcaggcggatttgaccgcgtggaaaaaaatcgtccac
gccatccaaaacccgaaacacaccgtcaaaatcgccatggtcggcaaatacgtcgatttg
accgagtcctacaaatcgctgatcgaagccttgaaacacgcaggcattcacaccgaaacc
gacgtgcagattacctttgtcgacagcgaaaacatcgagaaaaacaagggcgacgtttcc
atgcttaaagacatggacgccatcctcgttcccggcggtttcggttcgcgcggtgtggaa
ggcaaaatcgccgccgtgcgctacgcccgcgaaaacaacgtgccatacttgggcatctgc
ctcggtatgcagattgcgctgatcgaatacgcccgcgacgtggcaggcttgaaaggcgcg
aattccaccgagttcgacctcaaatgcgccgcgccagtcgttgccctgattgacgaatgg
caaactgccgacggcagcgtcgaaacccgcgacgaatccaccgatttgggcggcacgatg
cgtttgggcgcgcaagaagtcgaattgaaagcaggcagcctcgccgccaaaatctacggc
agcggacatatccgcgaacgccaccgccaccgctacgaagtcaacaacaactacgttcct
acactggaacaggcaggtttggtcatcggcggtgtatctgccggacgcgaacgcttggtc
gaaaccatcgaactgccgaaccatccttggttcttcgcctgccagttccaccccgagttt
acctccaatccgcgcaaagggcatcctttgttcaccgcgtttgtcaaagctgcgttgaac
aataaaaaagcctga

DBGET integrated database retrieval system