KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1558Help
Entry
NMB1558           CDS       T00027                                 

Gene name
dgkA
Definition
(RefSeq) diacylglycerol kinase
  KO
K00901  
diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    NMB1558 (dgkA)
   00564 Glycerophospholipid metabolism
    NMB1558 (dgkA)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     NMB1558 (dgkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1617770..1618153)
Genome map
AA seq 127 aa AA seqDB search
MEPSSYAAEKKGKGGIRRVINAFGYSIDGIAAAYRYEAAFRQVLWLNVLLVCAAFFWVSE
TAVRLPLIIASFVSVIVELFNTAVEAAVDHTSTEKHELAKLAKDAGSAAQLFAMLMLAAV
WLSALFG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggaaccttcctcctacgcggcagaaaaaaaaggcaaaggcggcatcaggcgcgtcatt
aacgcattcggctattcgatagacggcatcgccgccgcctaccgttacgaagcggcattc
cgtcaggttttgtggctgaacgtactgctggtgtgcgcggcatttttttgggtttccgaa
accgccgtccgcctgccgttgattatcgcgtcttttgtgtcggtcattgtcgaactgttc
aacaccgccgtcgaagctgccgtcgatcatacttcgaccgaaaaacacgagctggccaaa
ctcgccaaagacgcaggttctgccgcacaattgttcgcgatgctgatgttggcggcggtt
tggctgtctgccctgttcgggtaa

DBGET integrated database retrieval system