KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1559Help
Entry
NMB1559           CDS       T00027                                 

Gene name
gshB
Definition
(RefSeq) glutathione synthetase
  KO
K01920  
glutathione synthase [EC:6.3.2.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Cysteine and methionine metabolism
Glutathione metabolism
Metabolic pathways
Module
Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB1559 (gshB)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NMB1559 (gshB)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     NMB1559 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1618465..1619424)
Genome map
AA seq 319 aa AA seqDB search
MMKVLFIADPMASFKTYKDTTYAMMREMAKRGWRLFHTLSGELSVNGGLVTAQASAFEFL
GAKNDDDHAWFKSADKVQTALEAFDAVIMRTDPPFDMQYLYATQLLTLAEQQGAKVFNSG
QAMRDFNEKLAILNFSRFIAPTLVTTRSADVRTFLKEHGDIIIKPLDGMGGMGIFRLTEK
DPNIGSILETLMQLDSRTIMAQRYIPEIVHGDKRILIIGGEVVPYALARIPQNGETRGNL
AAGGRGVAQELGGRDREIAETLAPELKRRGILLAGLDVIGSNLTEVNVTSPTGFQEIMKQ
KGFDVAAMFADAVAAWSVR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagtcctctttatcgccgacccgatggcaagtttcaaaacctataaagacacc
acctacgcgatgatgcgcgaaatggcaaaacgcggctggcggctgtttcacacattgagc
ggggaattgtctgtaaacggcggtttggtaacggcgcaggcatcggcatttgaatttttg
ggtgcaaaaaacgatgatgatcatgcgtggttcaaatctgccgacaaagttcagacggca
ttggaagcatttgatgccgtgattatgcgtaccgatccgccgttcgatatgcaatacctc
tacgccacccaattactgacgctggcggaacagcagggcgcgaaggtctttaacagcgga
caggcgatgcgcgactttaatgaaaaactggcgattttgaacttcagccgctttatcgcg
cccacgctggtaacgacccgttccgccgatgtccgcacatttttgaaagaacacggcgac
atcatcatcaaaccgctcgacggcatgggcggtatgggaattttccgcctgaccgaaaaa
gaccccaacatcggcagcatcctcgaaaccctgatgcagcttgattcccgcaccattatg
gcgcaacgctacattcccgaaatcgtacacggtgacaaacgcatcctgattatcggcggc
gaagtcgtcccctatgctttggcgcgtatcccgcaaaacggcgaaacacgcggcaacctt
gcggcaggcgggcgcggcgtggcgcaggaattgggcggacgcgaccgcgaaattgccgaa
acgctcgcccccgaactcaaacggcgcggcatcctgctggccggtttggacgttatcggc
agcaacctgaccgaagtcaacgtaaccagcccgaccggattccaagaaattatgaaacaa
aaaggtttcgatgtggcggcaatgtttgccgatgccgttgccgcgtggtcggtacgttaa

DBGET integrated database retrieval system