KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1566Help
Entry
NMB1566           CDS       T00027                                 

Gene name
purN
Definition
(RefSeq) phosphoribosylglycinamide transformylase
  KO
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB1566 (purN)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NMB1566 (purN)
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     NMB1566 (purN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1625693..1626319)
Genome map
AA seq 208 aa AA seqDB search
MKNIVILISGRGSNMQAIVNAAIHNVRIAAVLSNSETAAGLQWAAERGIPTDSLNHKNFT
SRLAFDTAMMEKIDAYQPDLVVLAGFMRILTPEFCARYEGRLMNIHPSILPSFTGLHTHE
RALEAGCRVAGCTIHFVTAELDCGPIVSQGVVPILDGDTADDIAARVLAVEHKLYPKAVA
DFAAGRLIIEGNRVRNSENADAARFLTA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatcgtcatcctgatttctggacgcggcagcaatatgcaggcaatcgtcaat
gccgccattcacaacgtccgcattgccgccgtgttgagcaacagcgaaacggctgccggt
ttgcaatgggcggccgaacgcggcatcccgaccgatagcctgaatcataaaaactttaca
tcccggcttgccttcgataccgccatgatggagaaaatcgacgcatatcaacccgacttg
gtggttttggcaggttttatgcggattctgacccccgagttttgcgcccgttacgaaggc
aggctgatgaacattcacccgtccatccttccctcgtttaccggacttcatacgcacgaa
cgcgctttggaggcgggctgccgcgttgccggctgcaccatccatttcgttactgccgaa
ctggattgcggcccgattgtatcgcaaggggttgtgccgatactcgacggcgatacggca
gacgatattgccgcacgggttttggctgtcgagcataaactttatccgaaagccgttgcc
gattttgccgccggccgcctgattattgagggaaaccgcgtcagaaattcggaaaacgcc
gatgccgcccgttttctgacggcgtaa

DBGET integrated database retrieval system