KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1572Help
Entry
NMB1572           CDS       T00027                                 

Gene name
acnB
Definition
(RefSeq) aconitate hydratase B
  KO
K01682  
aconitate hydratase 2 / 2-methylisocitrate dehydratase [EC:4.2.1.3 4.2.1.99]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB1572 (acnB)
   01210 2-Oxocarboxylic acid metabolism
    NMB1572 (acnB)
   01230 Biosynthesis of amino acids
    NMB1572 (acnB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMB1572 (acnB)
   00630 Glyoxylate and dicarboxylate metabolism
    NMB1572 (acnB)
   00640 Propanoate metabolism
    NMB1572 (acnB)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     NMB1572 (acnB)
    4.2.1.99  2-methylisocitrate dehydratase
     NMB1572 (acnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1631974..1634559
Genome map
AA seq 861 aa AA seqDB search
MLEAYRKAAAERAALGIPALPLNAQQTADLVELLKSPPAGEGEFLVELLAHRVPPGVDDA
AKVKASFLAAVAEGSASSPLISPEYATELLGTMLGGYNIHALIELLDDDKLASIAAKGLK
HTLLMFDSFHDVQEKAEKGNKYAQEVLQSWADAEWFASRAKVPEKITVTVFKVDGETNTD
DLSPAPDAWSRPDIPLHALAMLKNPRDGITPDKPGEVGPIKLLEELKAKGHPVAYVGDVV
GTGSSRKSATNSVIWHTGEDIPFVPNKRFGGVCLGGKIAPIFFNTQEDSGALPIEVDVSA
LKMGDVVDILPYEGKIVKNGETVAEFELKSQVLLDEVQAGGRINLIIGRGLTAKAREALK
LPASTAFRLPQAPAESKAGFTLAQKMVGRACGLPEGQGVRPGTYCEPRMTTVGSQDTTGP
MTRDELKDLACLGFSADMVMQSFCHTAAYPKPVDVKTHKELPAFISTRGGVSLRPGDGVI
HSWLNRLLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGVMPLDMPESVLVRFSGK
LQPGVTLRDLVNAIPLYAIKQGLLTVAKAGKKNIFSGRILEIEGLPDLKVEQAFELTDAS
AERSAAGCTVKLNKEPIIEYMKSNVVLMKNMIANGYQDPRTLERRIKAMEKWLANPELLE
ADKDAEYAAVIEINMDDIKEPIIACPNDPDDVCFMSERSGTKIDEVFIGSCMTNIGHFRA
ASKLLEGKADTPVRLWIAPPTKMDAKQLSDEGHYGVLGRAGARMEMPGCSLCMGNQAQVR
EGATVMSTSTRNFPNRLGKNTFVYLGSAELAAICSKLGKIPTVEEYQANIGIINEQGDKI
YRYMNFNEIDSYNEVAETVNV
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgttagaagcctatcgtaaagccgccgccgagcgcgccgccctcggcattcccgccctc
cctttgaacgcgcagcaaaccgccgatttggttgagctgctgaaaagcccgcccgcaggc
gaaggcgagttcttggtcgaactgcttgcccaccgtgttccgcccggtgtggacgatgcc
gccaaagtcaaagcctcattcctggctgccgttgccgaaggcagcgcgtccagcccgctg
atctcccccgaatatgcgaccgaactcttaggtacaatgctcggcggttacaatattcac
gccttaatcgaactcttggacgacgacaaactcgcgtccattgctgccaaaggcttgaaa
catacgcttctgatgttcgattccttccacgacgttcaagaaaaagccgaaaaaggcaac
aaatacgcgcaagaagttttgcaatcttgggcagatgccgaatggttcgcctcacgcgcc
aaagttcccgaaaaaatcaccgttaccgttttcaaagttgacggcgaaaccaatacagac
gacctctcccccgcgcccgacgcgtggagtcgtcccgatattccgctgcacgcgctggcc
atgctgaaaaacccgcgcgacggcatcacgcccgacaaaccgggcgaagtcggtccgatt
aaattgttggaagaactcaaagccaaaggccatccggttgcttacgtcggcgacgtggtc
ggtactggttcttcacgcaaatccgcgaccaactccgtcatttggcataccggcgaagac
attccgttcgtgccgaacaaacgcttcggcggcgtatgtttgggcggcaaaatcgcgccg
attttcttcaatacccaagaagattccggcgcgctgccgattgaagtcgatgtatctgct
ctaaaaatgggcgatgtcgtcgatatcctgccttatgaaggcaaaatcgtgaaaaacggc
gagactgttgccgagtttgaattgaaatcacaagtattgctggacgaagtgcaagccggc
ggccgtatcaacctgattatcggccgaggtctgaccgccaaagcgcgcgaagccctgaaa
ctgcctgcctctactgcattccgcctgccgcaagcgcctgccgaaagcaaagccggtttc
accttggcgcaaaaaatggtcggccgcgcctgcggtctgcccgaaggacaaggcgtgcgc
ccgggtacttactgcgaaccgcgtatgacgacggtcggctcgcaagacacgaccggcccg
atgacccgcgacgagttgaaagacttggcttgtttgggcttctccgccgatatggtgatg
cagtctttctgccacaccgccgcctatccgaaacctgtcgatgtaaaaacccataaagaa
ctgcccgcctttatttccacccgtggcggcgtgtcactgcgtccgggcgacggcgtcatc
cactcgtggctcaaccgcctgctgctgcccgataccgtcggcaccggcggcgacagccat
acccgtttccccatcggtatttccttccccgccggctccggcttggttgcctttgccgcc
gcaacgggcgtaatgccgctcgatatgcccgagtctgtattggtacgcttcagcggcaag
ctgcaaccgggcgtaaccctgcgcgatttggtgaacgccatcccgctgtacgcaatcaaa
caaggtttgctgaccgttgccaaagccggtaagaaaaacatcttctccggccgcatcctc
gaaatcgaaggcctgcctgatttgaaagtggaacaagcctttgaattgaccgacgcatcc
gccgaacgctccgccgccggctgtaccgtgaagctcaacaaagagccgattatcgagtac
atgaaatccaacgtcgtgttgatgaaaaacatgattgccaacggctatcaagacccgcgc
actttggaacgccgcatcaaagctatggaaaaatggctggcaaatcccgagttgctcgaa
gcggataaagatgccgaatacgccgccgtgattgaaatcaacatggacgacatcaaagag
ccgattatcgcctgcccgaacgacccggacgacgtgtgcttcatgtccgaacgctccggc
accaaaatcgacgaagtattcatcggttcgtgtatgaccaacatcggccacttccgcgcc
gcctccaaacttttggaaggcaaggcagacacccccgtccgcctgtggattgcgccgccg
accaaaatggacgcgaaacaattgtccgacgaaggacactacggcgtactcggacgtgcc
ggcgcgcgtatggaaatgccgggttgctccttatgtatgggtaatcaggcgcaagtacgc
gaaggtgcgaccgttatgtccacctccacccgcaacttcccgaaccgtttgggtaaaaac
acctttgtttacctcggttcggcggaattggcagcgatttgctccaaactgggtaaaatc
ccgaccgttgaagaatatcaagccaatatcggcatcatcaacgaacagggcgataaaatc
taccgctatatgaacttcaacgaaatcgacagctacaacgaagtagccgagaccgtgaac
gtttaa

DBGET integrated database retrieval system