KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1573Help
Entry
NMB1573           CDS       T00027                                 

Gene name
argF
Definition
(RefSeq) ornithine carbamoyltransferase
  KO
K00611  
ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Arginine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB1573 (argF)
  Amino acid metabolism
   00220 Arginine biosynthesis
    NMB1573 (argF)
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     NMB1573 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1634701..1635696
Genome map
AA seq 331 aa AA seqDB search
MNLKNRHFLKLLDFTPEEITAYLDLAAELKAAKKAGREIQRMKGKNIALIFEKTSTRTRC
AFEVAARDQGAGVTYLEPSASQIGHKESIKDTARVLGRMYDAIEYRGFGQEVVEELAKYA
GVPVFNGLTNEFHPTQMLADALTMREHSGKPLNQTAFAYVGDARYNMGNSLLILGAKLGM
DVRIGAPQSLWPSEGIIAAAHAAAKETGAKITLTENAHEAVKNVDFIHTDVWVSMGEPKE
VWQERIDLLKDYRVTPELMAASGNPQVKFMHCLPAFHNRETKVGEWIYETFGLNGVEVTE
EIFESPASIVFDQAENRMHTIKAVMVAALGD
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgaacctgaaaaaccgccattttctgaaacttttagacttcacgccggaagaaatcacc
gcctacctcgaccttgccgccgaattgaaagccgccaaaaaagcagggcgcgagattcag
cggatgaaagggaaaaacatcgccctgatttttgaaaaaacctctactcggacgcgctgc
gcgtttgaagtcgccgcgcgcgatcaaggcgcgggagtgacttatttagagccgtccgcc
agccaaatcgggcataaggaaagcatcaaagacaccgcccgcgtgttgggcaggatgtac
gatgccatcgaatatcgcggtttcggtcaggaagttgttgaagaattggcgaaatacgcg
ggcgtacccgtgttcaacgggctgaccaacgagttccatcccacacaaatgcttgccgac
gcactgactatgcgcgaacacagcggcaaacctttgaaccaaaccgcgtttgcctacgtc
ggcgacgcgcgttacaacatgggcaattccctgctgattttaggggcaaaattggggatg
gacgtgcgtatcggcgcaccgcaaagcctgtggccgtctgaaggcattattgccgccgca
cacgccgccgccaaagaaaccggcgcaaaaattaccctgaccgaaaacgcgcatgaagcc
gtgaagaatgttgattttattcataccgatgtgtgggtcagcatgggcgagccgaaagaa
gtctggcaggaacgcatcgatttgctgaaagattaccgcgttacgcccgaactgatggcg
gcatcgggcaatccgcaagtcaaattcatgcactgcctgcccgccttccacaaccgcgaa
accaaagtcggcgaatggatttacgaaaccttcgggctgaacggtgtggaagttacagaa
gaaatattcgaaagccccgccagcatcgtgttcgatcaggcggaaaaccgtatgcacacg
attaaagcggtaatggtcgcggctctgggcgactga

DBGET integrated database retrieval system