KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1574Help
Entry
NMB1574           CDS       T00027                                 

Gene name
ilvC
Definition
(RefSeq) ketol-acid reductoisomerase
  KO
K00053  
ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    NMB1574 (ilvC)
   01230 Biosynthesis of amino acids
    NMB1574 (ilvC)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    NMB1574 (ilvC)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NMB1574 (ilvC)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     NMB1574 (ilvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1635920..1636933)
Genome map
AA seq 337 aa AA seqDB search
MQVYYDKDADLSLIKGKTVAIIGYGSQGHAHAANLKDSGVNVVIGLRQGSSWKKAEAAGH
VVKTVAEATKEADVVMLLLPDETMPAVYHAEVTANLKEGATLAFAHGFNVHYNQIVPRAD
LDVIMVAPKGPGHTVRSEYKRGGGVPSLIAVYQDNSGKAKDIALSYAAANGGTKGGVIET
TFREETETDLFGEQAVLCGGVVELIKAGFETLTEAGYAPEMAYFECLHEMKLIVDLIFEG
GIANMNYSISNNAEYGEYVTGPEVVNASSKEAMRNALKRIQTGEYAKMFIQEGNVNYASM
TARRRLNADHQVEKVGAQLRAMMPWITANKLVDQDKN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtctattacgataaagatgccgatctgtccctaatcaaaggcaaaaccgttgcc
atcatcggttacggttcgcaaggtcatgcccatgccgccaacctgaaagattcgggtgta
aacgtggtgattggtctgcgccaaggttcttcttggaaaaaagccgaagcagccggtcat
gtcgtcaaaaccgttgctgaagcgaccaaagaagccgatgtcgttatgctgctgctgcct
gacgaaaccatgcctgccgtctatcacgccgaagttacagccaatttgaaagaaggcgca
acgctggcatttgcacacggcttcaacgtgcactacaaccaaatcgttccgcgtgccgac
ttggacgtgattatggttgcccccaaaggtccgggccataccgtacgcagtgaatacaaa
cgcggcggcggcgtgccttctctgattgccgtttaccaagacaattccggcaaagccaaa
gacatcgccctgtcttatgcggctgccaacggcggcaccaaaggcggtgtgattgaaacc
actttccgcgaagaaaccgaaaccgatctgttcggcgaacaagccgtattgtgcggcggc
gtggtcgagttgatcaaggcgggttttgaaaccctgaccgaagccggttacgcgcctgaa
atggcttacttcgaatgtctgcacgaaatgaaactgatcgttgacctgattttcgaaggc
ggtattgccaatatgaactactccatttccaacaatgcggagtacggcgaatacgttacc
ggccctgaagtggtcaatgcttccagcaaagaagccatgcgcaatgccctgaaacgcatt
caaaccggcgaatacgcaaaaatgtttatccaagagggtaatgtcaactatgcgtctatg
actgcccgccgccgtctgaatgccgaccaccaagttgaaaaagtcggcgcacaactgcgt
gccatgatgccttggattactgccaacaaattggttgaccaagacaaaaactga

DBGET integrated database retrieval system